KEGG   Opitutus terrae: Oter_1386Help
Entry
Oter_1386         CDS       T00689                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ote  Opitutus terrae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_1386
   00052 Galactose metabolism
    Oter_1386
Enzymes [BR:ote01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Oter_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1734525..1735679
Genome map
AA seq 384 aa AA seqDB search
MKNILRLVCSSVAVLQLAVPLLTAAPSSPVITMKSFGQLPDGRQTHLYTLENASGFRADI
TDLGGIVVNLLVPDKNGQLADVSLGFDNAAQYLKESPFFGALIGRYGNRIAHGKFTLDGQ
TYSLPLNDKPGDIPCSLHGGTVGFDKVLWQGRPQIIDGNPALVLTYVSRDGEQGYPGTLT
VEVTYTVTPKNELRIDYSATTDKATPVNLTNHTYFNLHGEGEGTILDHVLMMKAAKTTPV
NAGLIPTGEIVSVAGTPLDFTKPHVIGERIDADNEQLKFGGGYDHNWVLDNQDGKLALAA
TVHEPQSGRFMEVFTTEPGLQFYSGNFLTGAITGKSGKKYPHRSGLCLETQHYPDSPNQP
AFPSTILRPGKKLTSTTVYRFSTK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcctgcggctggtctgttccagtgttgctgtcctgcagcttgcggttccg
ctgctcaccgcggcgccttcctctcctgtcattaccatgaaatcattcggtcaactgccg
gacggtcggcagacccatctgtacacgctcgagaacgccagcgggtttcgcgccgacatc
accgacctcggtggcatcgtcgtgaacctgctcgtgccggacaagaacggccagctggcg
gacgtgtcgctcggcttcgacaacgccgcgcagtatttgaaggagtcgccgtttttcggc
gcgctgatcggccgctatggcaaccggatcgcgcacgggaagttcacgctcgacgggcag
acgtattcgctgccgctgaacgacaagcccggtgacatcccgtgctcgctccatggcggc
acggtgggctttgacaaggtgctctggcaggggcgcccgcagatcatcgatggcaacccg
gcgctggtcctcacctatgtcagccgcgacggcgaacagggttaccccggcacgctcacc
gtcgaggtcacctatacggtcacgccaaagaacgagctccggatcgattactcggcgacc
accgacaaggcgacgccggtcaacctgacgaaccacacatatttcaacctgcacggcgag
ggcgagggcacgattctcgaccacgtgctgatgatgaaggcggcgaagaccacgccggtg
aacgcggggctgatcccgaccggcgagatcgtgtcggtcgcgggcacgccgctcgacttc
acgaagccacatgtgatcggcgaacggatcgatgcggacaatgagcagctgaagttcggc
ggcggctacgaccacaattgggtgctcgacaaccaggacgggaagctcgcgctggccgcc
acggtgcacgagccgcagtcgggccggttcatggaagtgttcacgaccgaaccgggcctc
cagttttactcgggcaatttcctcaccggcgcgatcaccggcaagagcgggaagaagtat
ccgcatcgcagcgggctgtgcctggagacgcagcactatcccgattcgccgaatcaaccg
gccttcccgagcaccatcctgcggccgggcaagaaactcacgagcacgacggtctatcgt
tttagcaccaaatag

DBGET integrated database retrieval system