KEGG   Opitutus terrae: Oter_1401Help
Entry
Oter_1401         CDS       T00689                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ote  Opitutus terrae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_1401
   01230 Biosynthesis of amino acids
    Oter_1401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_1401
   00030 Pentose phosphate pathway
    Oter_1401
   00051 Fructose and mannose metabolism
    Oter_1401
   00052 Galactose metabolism
    Oter_1401
  Energy metabolism
   00680 Methane metabolism
    Oter_1401
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Oter_1401
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Oter_1401
Protein phosphatases and associated proteins [BR:ote01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Oter_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1761384..1762640)
Genome map
AA seq 418 aa AA seqDB search
MAELVGNVLVGQSGGPTAVINASVAGIVAEALNHECIEEIYGALNGVLGILQEDLIDLAA
ESQQQIRALRHTPGAALGTCRYKLKKQSDYERVLEVFKAHNIRYFFYIGGNDSQDTADKI
SKLAQQQGYELRVIGVPKTIDNDLPITDHTPGYGSVVKYTATTIRELACDHEAMGQGDLV
SIVEVMGRSAGWIAAGAALAKRRDHPHDPPHLIYLPEIPFDQAKCLEDVRRVLKREKFCM
VVVGEGLIDADGNYVAADAATDSFGHAQLGGAGDFLKELVETNIPGVKARLAKPGIIQRA
AAHAGSKTDADEAFLAGQAAVQAAIKGETDKMVTLVRGDTDHYTCETGLAPLAEIANGVK
KLPREWINEDGTSMNFQFLRYAQPLIQGEVAVPFESGVPVFARLDKVRVDKTLPAFVA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcgtaggaaatgtcttggtgggccagtcgggtggccctaccgccgtcatc
aacgcgagcgttgccggaattgtggccgaagcgctcaaccacgagtgcattgaagagatc
tatggcgcgttgaacggcgtcctcgggatccttcaggaagatctgatcgacctcgccgct
gagtcccagcagcagatccgcgcgctccggcacactccgggtgcggcgctcggcacctgc
cgctacaagctgaagaagcagtccgactacgagcgcgtgctcgaggtcttcaaggcgcac
aacatccgctactttttctacatcggcggcaatgactcgcaggacaccgccgacaagatc
tccaagctcgcgcagcagcagggctacgaactgcgcgtcatcggcgtgccgaagacgatc
gacaacgatctcccgatcaccgaccacacgccgggctacggcagcgtggtgaaatacacc
gccacgacgatccgcgagctcgcctgtgatcacgaagccatgggccagggcgatctcgtc
tcgatcgtggaagtcatgggccgcagcgcgggctggattgccgccggcgccgcgctggcg
aagcgccgcgatcacccccacgatccgccgcacctgatttacctcccggaaatcccgttc
gaccaggccaagtgcctcgaggacgtccgccgcgtgctcaagcgcgagaaattctgcatg
gtcgtcgtcggcgagggcctgatcgacgccgatggcaactacgtcgccgccgatgcggcg
accgattcgttcggtcacgcgcagctcggcggcgcgggcgattttctgaaggagctggtc
gagacgaatattccaggcgtgaaagcccgcctcgcgaagccgggcatcatccagcgcgcc
gccgcccatgccggctcgaagaccgacgccgacgaggcgttcctcgccggccaggccgcc
gtgcaggccgcgatcaagggcgaaaccgacaagatggtcacgctcgtccgcggtgacacg
gaccactacacctgtgagaccgggctggcgccgctcgccgagatcgccaacggcgtgaag
aagctgccgcgcgagtggatcaacgaggacggcacgagcatgaacttccagttcctgcgc
tatgcccagccgctgattcagggcgaggtcgccgtgccgttcgagagcggcgtgccggtg
ttcgcgcggctcgacaaggtgcgcgtcgacaagacgctgccggcgttcgtcgcctga

DBGET integrated database retrieval system