KEGG   Opitutus terrae: Oter_1488Help
Entry
Oter_1488         CDS       T00689                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ote  Opitutus terrae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Oter_1488
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Oter_1488
Exosome [BR:ote04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oter_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1849717..1851213)
Genome map
AA seq 498 aa AA seqDB search
MSAEFILALDQGTTSTRAIVFDHAGRARATAQQEFPQHFPRAGWVEHDPRDLWETTRRVA
LAAVAEANLTAADLAAVGLTNQRETTLLWDRRTGEPVAPAIVWQDRRTADFCARLAARGL
GPLFRKRTGLVLDPYFSGTKLRWLLDHVPGARRRANRGELAFGTVDTWLLWQLTGGRVHA
TEVSNASRTLLLNLRTGAWDDELLGLLRIPREVLPEVRATSEVLGEISALPALRGVPVAG
MAGDQQAALFGQACFRPGMAKNTYGTGCFLLQHTGTQPIASRHQLLTTIAWKLGPQAPLE
YALEGSVFIGGAVVQWLRDGLGLIARSSDIESLAARAVDNGGVYVVPAFAGLGAPHWDPA
ARGAILGLTRGTTAAHLARAAIESIAYQSADLLGAMQADSGRKLRELRVDGGATVNDALL
QFQSDLLRVPVIRPQVTETTALGAAYLAGLAVGFWRDRSQLAQRWARQRTFTPQAPRGAM
ARLQVDWRRAVERAKAWA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaattcatcctcgcgctggaccagggcaccacgtcgacgcgcgcgatcgtg
ttcgatcacgccggccgcgcgcgcgccaccgcccagcaggaattcccgcaacatttcccg
cgcgccggatgggtcgagcacgacccgcgcgatctgtgggaaaccacgcgccgcgtcgcg
ctcgccgcggtcgccgaggccaacctcaccgccgccgatctcgccgccgtcgggctcacc
aatcagcgcgaaaccacgctgctgtgggaccgccgcacgggtgaacctgtcgcgcccgcg
atcgtgtggcaggatcggcgcaccgccgatttctgcgcgcggctcgcggcccgcgggctc
ggcccgttgtttcgcaaacgcaccgggctggtcctcgatccgtatttctccggcacgaaa
cttcgctggctgctcgaccacgtgcccggcgcgcggcgccgggccaaccgcggcgagctc
gcgttcggcaccgtggatacctggttgctctggcaactgaccggcggccgcgtgcacgcg
accgaggtctcgaacgcctcgcgcacgctgctgctgaatctccgcaccggcgcttgggac
gacgagctgctcgggttgctgcggattccgcgcgaagtgctgccggaagtccgcgcgacc
agcgaggtgttgggcgaaatcagcgcgctgccggcactgcgcggcgtgcccgtcgccggc
atggccggcgatcagcaggcggcactcttcggccaggcctgtttccgccccggcatggcc
aagaacacttatggcacgggctgcttcctgctccagcacaccggcactcagcccatcgcc
tcgcgtcatcaactgctcaccacgatcgcctggaagctcggtccgcaagcgccgctcgaa
tatgcgctcgaaggcagcgtgttcatcggcggcgccgtggtacagtggctgcgcgacgga
ctcgggctgatcgcccgctcgagcgacatcgaatcgctcgccgcccgcgccgtggacaac
ggcggcgtgtatgtggtccccgccttcgccggactcggcgcgccgcattgggatcccgcc
gcgcgcggcgcgatcctggggctgacccgcggcacgaccgccgcccacctcgcccgcgcc
gcgatcgagagcattgcgtatcaaagcgccgatctgctcggcgccatgcaggcggactcc
ggccgcaagctgcgggagctccgcgtcgacggcggtgcaaccgtcaacgatgctttgctg
caatttcaaagcgatctgctgcgcgtgccggtgatccgcccgcaggtcaccgagaccacc
gccctcggcgccgcctacctcgcgggactggccgtcggcttttggcgcgatcgcagccaa
ctcgcgcagcgttgggcgcgacagcgcacgttcacgccacaggcgccgcgcggggccatg
gcacgactgcaagtggactggcgccgcgccgtggagcgcgccaaggcttgggcgtag

DBGET integrated database retrieval system