KEGG   Opitutus terrae: Oter_1629Help
Entry
Oter_1629         CDS       T00689                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ote  Opitutus terrae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ote00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Oter_1629
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Oter_1629
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Oter_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2002921..2003826
Genome map
AA seq 301 aa AA seqDB search
MPELPDVTVYLEALERRLIGRVLEKIRLLDLFVLRTALPPIDSLESRRVERLRRLGKRIA
LGFDDGRWLVIHLMIAGRLQWTPPGEKSRAKNVIAEFRFENGTLALTEAGTKRRASLHVV
ADEAGLEAHDRGGIDVLTCSPEEFRGRLMRENHTLKRALTDPQLFSGIGNSYSDEILHAA
KLSPVTLTQKLSPEEIARLHRSTREVLMAWTDRLRREAGEGFPEKVTAFRPEMAVHGKFG
KPCPVCGTTVQRIVYAENEVNYCPRCQTGGRLLADRSLSRLLKQDWPRTVEEAEAAKQAR
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgccggacgtcacggtttatctcgaagcgcttgagcggcggctgatcggc
cgcgtgctcgagaagatccgattgctcgacctcttcgtgctgcgcaccgcgctgccgccg
atcgattcgctcgagtcgcggcgcgtggagcgactccggcggctcggcaagcggatcgca
ctcggtttcgacgacggccgttggctcgtgattcacctgatgatcgccggccggctgcag
tggacgcccccgggggagaagagccgcgcgaaaaatgtcatcgccgaattccggttcgag
aacggcacgctcgctctgaccgaggcgggaacgaagcggcgcgcctccttgcacgtcgtg
gccgacgaagcaggactggaggcacacgatcgcggcgggatcgacgtgctgacgtgttcg
cccgaggagtttcgcggacggctcatgcgcgagaatcacacgctgaagcgcgcgttgacg
gatccgcagctcttcagcggaattggcaactcgtattccgacgagatcctgcacgcggcg
aaattgtcaccggtgacgttgacccaaaaactgtcgcccgaggaaatcgcccggctgcat
cgaagcacgcgcgaagtgctgatggcatggacggatcgcttgcgccgggaagcaggcgag
gggtttcccgagaaagtgaccgccttccggccggaaatggcggtgcacggaaaatttggg
aagccgtgtccggtgtgcggcacgaccgtgcagcggatcgtgtatgccgagaacgaggtg
aactactgcccgcgctgccagacgggcgggcggttgctcgcggatcgttcgctctcgcgg
ctgctgaaacaggactggccgcgcacggttgaggaagcggaggcggcgaagcaggcgcgg
cgctga

DBGET integrated database retrieval system