KEGG   Opitutus terrae: Oter_1757Help
Entry
Oter_1757         CDS       T00689                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ote  Opitutus terrae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Oter_1757
   00051 Fructose and mannose metabolism
    Oter_1757
Enzymes [BR:ote01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Oter_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2177500..2178834
Genome map
AA seq 444 aa AA seqDB search
MKKARLHFPRIRPIAYEGPTSSSALAFRHYNPEEVIDGKTMAQHMRFSIAYWHTFASDGR
DQFGAGTLHQGRPWERSGDAMSVALARLDAGFEFFQKIQAPFWCFHDRDIAPEGRSLAES
NRLLDRVVAHAKELQKETGIKLLWGTANLFSNPRYMSGASTNPDAHVFAYAAAQVKKALE
VTKQLGGENYVFWGGREGYETLLNTNLKREQDHLAAFLHMAVDYAKEIGFKGQFLIEPKP
KEPTKHQYDFDVASGIAFLRTYGLEKYFKFNIETNHATLAGHTFSHEIEVAASQGMLGSI
DANTGDLLLGWDTDQFNTDVKELTLAMVSILKAGGLGSGGFNFDAKVRRQSIDLDDLFHA
HIGGMDAYALAFKIARRILADGKFEQFVADRYASFDSDYGRDIEKGRIGFKELNKLVLNK
LGEPKPRSGKQEYLENLLNSYLHG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctcgcctgcacttcccccgcatccggcccatcgcctacgagggccccaca
tcgtcgagcgcgctcgcgtttcgacattacaaccccgaagaggtgatcgacggaaagacg
atggcgcagcacatgcgcttctccatcgcctactggcacacgttcgccagcgacggccgc
gaccagtttggcgcgggcacgctgcaccaaggccgcccgtgggaacggagcggcgatgcg
atgtcggtcgcgctcgcccggctcgatgccggttttgaattcttccagaaaatccaggcg
ccgttctggtgcttccacgatcgcgacatcgccccggagggccgctcgctcgcggagtcg
aaccggctgctcgaccgtgtcgtcgcgcacgcgaaggagcttcagaaggagacgggcatc
aagctgctgtggggcacggcgaacctgttcagtaatccgcgctacatgtcgggggcgtca
accaacccggacgctcacgttttcgcctacgccgcggcgcaggtgaagaaggcgctcgag
gtcacgaagcagctcggcggcgagaactacgttttctggggcggccgcgaaggctacgag
acgctgctcaacacgaatctcaagcgcgagcaggatcatctcgcggcgttcctccacatg
gcggtcgattacgcgaaggagatcggcttcaagggccagttcctgatcgagccgaagccg
aaggaaccgacgaagcaccaatatgacttcgacgtggccagcgggatcgcgttcctgcgc
acctacgggctggaaaagtatttcaagttcaacatcgagaccaatcacgccacgcttgcc
ggccacacgttcagccacgagatcgaggtggccgcgtcgcagggcatgctcggctccatc
gatgcgaacaccggcgacctgctactcggctgggacaccgaccagttcaacaccgacgtc
aaggaactcacgctcgcgatggtctcgatcctcaaggcgggcggcctgggctcgggcggt
ttcaacttcgatgcgaaggtccgtcgccagtccatcgatctcgacgatctgttccacgcg
catatcggcggaatggatgcctacgcgctggcgttcaagatcgcgcgtcggatcctggcc
gatggcaagttcgagcagttcgtggcggaccgctatgccagcttcgattccgactacggc
cgcgacatcgagaagggccgcatcggattcaaggagctgaacaaactcgtgctgaacaag
ctcggcgagccgaagcctcgctccggcaagcaggagtatctcgagaacctcctcaacagc
tacctgcacggctga

DBGET integrated database retrieval system