KEGG   Opitutus terrae: Oter_1803Help
Entry
Oter_1803         CDS       T00689                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ote  Opitutus terrae
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Oter_1803
Enzymes [BR:ote01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Oter_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2240305..2242251
Genome map
AA seq 648 aa AA seqDB search
MKRSLHTPLALSLLSLTVLLGGCGRPGGDGAGNGKSGKADANSAAVKTYVAPGQKDEFYL
FYSGGHSGQIFVAGIPSMRHLITIPVFTPSPGTGYGFDEETKKMLGGYTWGDVHHPGLSQ
TDGKYDGRWLFVNDNANNRIARVDLRDFKTKQILGPIPNSSGNHGSSFVTENTENVLVAT
RFSVPLPKGRYAELNDYEKEFNGMVSGIKVDPQSGEMSVGWQILTPPFDWDLGSTGKGPS
SGWAFWTSYNTEMAHDQLEVNASQRERDYAAVVNWKAAEAAVREGKGTDMDGVPVIDPAK
VPGVLYFLPVPKSPHGIDVDPSGRWIAAGGKLQPTASVFDFEKIRVAIEKRDFEGEFRGV
PILRFESVLEGEVPVGLGPLHTQYDGKGNAYTSLFIESVVTKWKLPPWTDEQKKDLSKAV
IDKIPVHFNIGHLVIGGSDTKEPYGRYLVAGNKLSKGRHLSTGPSQPESSQLIDITGEKM
AMLYETFTDPEPHFMQILKADVIKPIEVYPKAENKNPNAVWDAKDTSVTRSGNTVEVKAL
AIRSHFAPERIDAQVGDEVVVHLTNVEQTPDMIHGWGLAEHDINIIVDPGETKTVRFKVT
KPGVFPFYCTNFCSALHQEMQGYLAVKPASTASTAPVPTGAGAVAAMP
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatccctgcataccccgctcgctctctccctgctctcgttgaccgtgctcctc
ggcggctgcggccgacccggaggcgatggcgcgggcaacggcaagtccggcaaagccgac
gccaactccgccgcggtgaaaacctatgtcgcgccgggccagaaggacgagttctacctg
ttctactcgggtggtcactcgggtcagatcttcgtggccgggattccgtcgatgcggcac
ctgatcacgattcccgtgttcacgcccagcccgggcactggctacggcttcgatgaggaa
acgaagaagatgctcggcggctacacctggggcgacgttcatcaccccgggctctcgcag
acggacggtaaatacgacggtcgctggctgttcgtgaacgacaacgccaacaaccgcatc
gcgcgcgtcgacctgcgggatttcaaaaccaagcagattctcgggccgattcccaattcc
agcggcaatcacggttcctcgttcgtgaccgagaacaccgaaaacgtcctcgtcgcgacg
cgcttttccgtcccgttgccgaaaggccgctacgccgagctgaacgactacgagaaggag
ttcaacggcatggtcagcggcatcaaggtcgatccgcagagcggcgagatgtcggtcggc
tggcagattctcacgccgccgtttgattgggatctcggctcgaccggcaagggcccgagc
tcgggctgggcgttctggacctcttacaacacggagatggcgcacgatcagctcgaggtg
aacgcctcgcagcgcgagcgcgactacgctgctgtggtgaactggaaagccgccgaagcc
gccgtacgcgagggcaagggcaccgacatggacggcgtgccggtaatcgatccggcgaag
gtgcctggcgtcctctacttcctgccggtgcccaagtctccccacggcattgatgtcgat
ccgtcgggccgctggatcgcagctggcggcaagctgcagccgaccgcctcggtgttcgat
ttcgagaagatccgcgtcgcgatcgagaagagggatttcgagggcgagttccgcggggtt
ccgatcctgcggttcgaatccgtgctcgagggcgaagtgccggtcgggctcggtccgctg
cacacgcagtatgacggcaagggcaatgcctacacctcgctgttcatcgagtcggtggtc
acgaagtggaagctgccgccgtggaccgacgagcagaagaaggatctctccaaggccgtc
atcgacaagatcccggtgcatttcaacatcggtcacctggtgatcggcggttcggatacg
aaggagccttacggtcgttatctggtcgccggcaacaagctctcgaaggggcggcacctc
agcacgggtccgtcgcagcccgagagcagccagttgatcgacatcaccggcgaaaagatg
gccatgctctacgagacgttcacggatccggagccgcacttcatgcagatcctgaaggcc
gacgtcatcaagccgatcgaggtttatccgaaggcggagaacaagaacccgaacgccgtc
tgggacgcgaaggacacgagcgtcacgcgcagcggcaacaccgtcgaggtgaaggcgctt
gcgatccggagtcatttcgcgccggagcggatcgatgcgcaggtgggcgacgaggtcgtg
gtgcacctgaccaatgtcgagcagacgcccgacatgatccatggctggggcctggccgag
cacgacatcaacatcatcgtggatccaggcgaaaccaagacggtgcgtttcaaggtgacg
aagccgggcgtgtttccgttctactgcacgaacttctgctcggcgctgcaccaggagatg
caggggtacctggcggtgaaacccgccagcacggcgagcaccgcgccggtgccgacgggc
gctggcgccgtggccgcgatgccatga

DBGET integrated database retrieval system