KEGG   Opitutus terrae: Oter_2012Help
Entry
Oter_2012         CDS       T00689                                 

Definition
malto-oligosyltrehalose synthase (EC:5.4.99.15)
Orthology
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
ote  Opitutus terrae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ote00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2591179..2594016
Genome map
AA seq 945 aa AA seqDB search
MQARRIPVATYRLQLRREFPFAAAEAVIAHAHAFGISDYYVSPILLSTPGSSHGYDVTDY
RLINPELGGREGFSRLHDALRARQMGLVLDFVPNHMGINAPGLLNTWWRDVLQNGVHSRY
AGFFDIDWSGTGEGAAQVLVPILDDHYGRVLEAGRLALRCERGVIGVHYGDMQFPVRPQT
YQSLLNAAAESMPAAAQLRELAEEFGALPRAEATEDFERAAERTKRVAELKRRLGTLLEQ
QPAARAALEERLHALEGRTGEPRSFDALDEVISQQHYRLAYWRAGQHETNYRRFFAIDTL
IGLRMEEPEVFEETHALLSRLLVEGTVTGLRIDHIDGLRQPQRYLERLQALAMRTGDEAR
DPLYVLVEKILADHEPLPVEWPTHGTTGYEFIAQIAGVLVDPQAERYFSEHYAEFTGETA
AFEDVVYQKKLLVLEELFANAVLKLATDLTDLVRSERRWRDVSRNELTVAVREVMAAHGV
YRTYRRGPAPMEARDRRVVEQASAIAIARNPRLGAAPIELVRDVLTGDFPPEDPAEAERA
AQPTQALRARLADWVLSFQQYTGAIMAKAVEDTAFYTYSRFIALNEVGGNPGRFGGTVAG
FHAANEERLRRTPHALLALATHDTKLGEDARARLYALSELPHEWHESLQEWRQMNQRHKT
MVDGRAAPDANEEYRLYQILLAAWPADDADPDDGFRERIREHLRKAVNEAKRNTTWVQPN
ERWIEAGDRFVDALLSLESGREFLASFRPRAGRLAHLGLVNTLTQTVLKITSPGVPDFYQ
GTELWDLSLVDPDNRRPVDFDLRSRLTQKPLDGLRWAELFRDWRSGEIKLQIARALLQFR
GTHRELFQQGEYWPLQTRGRFRDKVVAFARVIGEEAMLVVAPRLTSALGCPPLGLVWDDT
TLVLPTGGGKRWRDVVTGCEHAGEAGELRLSELLAELPFAVLASG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcggcgcatccccgtggccacctaccgactgcaattgcggcgcgagtttccg
ttcgccgccgcggaggcggtgatcgcgcatgcgcacgcgttcggcatttccgactattac
gtttcgccgatcctgctctccacaccgggcagttcgcacggctatgacgtaaccgattac
cgtttgatcaatccggagctcggcggtcgcgagggctttagtcgactgcacgacgccctg
cgcgcgcggcagatgggcctggtgctcgacttcgtgccgaatcacatggggatcaacgcg
ccgggcctgttgaacacctggtggcgcgacgtgctgcagaatggcgtgcattcgcgctac
gcggggtttttcgatatcgactggagcggcaccggcgagggcgcggcgcaggtgctggtg
ccgatcctcgacgatcactatggccgcgtgctcgaggcggggcggctggcgctccgctgc
gaacggggcgtcatcggcgtgcactatggcgacatgcagtttccggtgcggccgcagacg
taccaatcgttgttgaacgcggccgcggagtcgatgccggcggcggcccagctgcgggag
ctggcggaggaattcggcgctctgccgcgggccgaggccaccgaggatttcgagagggcg
gcggagcggaccaaacgcgtggcggaattgaaacgccggctgggaacgctgctcgagcag
cagcccgcggcgcgcgcggcgcttgaggagcggttgcacgcgctggaagggcggaccggc
gagccgcgcagcttcgatgcgctcgacgaggtgatctcgcagcagcactaccgactggcc
tactggcgcgcggggcagcacgaaacaaattaccggcggtttttcgcgatcgacacgctg
attggattgcggatggaggagccggaggtgttcgaggaaacccacgccttgctctcgcgc
ctgctggtggaaggcaccgtgaccggactgcggatcgatcacatcgacggcttgcggcag
ccgcagcggtacctcgagcgcttgcaggcgctcgcgatgcgaaccggtgacgaagcgcgc
gatccgctctatgtgctggtggaaaagatcctggccgaccacgaaccgctcccggtcgag
tggccgacgcacggcaccacgggctacgagttcatcgcgcagatcgccggtgtgctcgtg
gatccccaggccgagcgctatttcagcgaacactatgccgaattcaccggcgaaacggcg
gcgttcgaggatgtcgtgtaccaaaaaaagctgctggtgctcgaagagctgttcgccaac
gcggtgctcaagctggcgaccgacctgacggacctggtgcgcagcgaacgtcgctggcgg
gacgtgtcgcgcaacgagctcacggtcgcagtgcgcgaagtgatggcggcccatggagtt
tatcgcacgtatcgtcgggggccggcgccgatggaggcgcgtgaccggcgcgtcgtggag
caggcgagtgcgatcgcgatcgcgcgcaatccgcggctcggcgcggcgccgatcgagctc
gtgcgcgacgtgctcaccggcgatttcccgccggaggatccggccgaggccgagcgcgcc
gcgcaaccgacgcaggcgctgcgcgcgcggctggccgactgggtgttgagctttcaacaa
tacaccggcgcgatcatggcgaaggcggtcgaagacaccgcgttttacacctacagccgg
ttcatcgcgttgaacgaggtcggcggcaatcccggccggttcggcggcaccgtggcagga
tttcacgcggcgaatgaggagcggctgcggcgcacgccgcacgcgctgctcgcgctcgcc
acgcacgacacgaagctcggggaggatgcgcgggcccggctctacgcgctgtcggagctc
ccgcacgaatggcacgagagtctgcaggaatggcggcagatgaaccagcggcacaagacc
atggtcgatggtcgcgccgcgccggatgcgaacgaggaatatcggctgtatcagatcctg
ctggcggcgtggccggcggacgacgccgatccggacgatggtttccgcgagcggattcgc
gagcacctgcgcaaggccgtcaacgaggcgaagcgcaacaccacctgggtgcagcccaac
gaacgctggatcgaggcgggcgatcgcttcgtggacgcattgctgtcgttggagagcggc
cgcgagttcctggcgagcttccggccgcgtgcggggcggctcgcgcatctcgggttggtg
aacaccctcacgcagacggtgctgaaaatcacgtcgccgggcgtgccggatttttatcag
ggcacggagctgtgggatttgagcctggtggatcccgacaaccggcgcccggtggacttc
gacctgcgcagccggctcacgcagaaaccgctcgacggactgcgttgggccgagctgttc
cgggattggcgcagcggggagatcaagctgcagatcgcgcgcgcgctgctgcagttccgt
ggaacgcaccgcgagctgtttcagcagggcgagtattggccgctgcagacgaggggacgt
tttcgcgacaaggtggtcgcgtttgcccgcgtgatcggcgaggaggcgatgctcgtggtc
gcgccgcggttgacgagtgcactcgggtgtccgccgctggggctggtgtgggacgacacc
acgctcgtgctcccgacaggcggggggaagcgctggcgcgatgtcgtgaccggctgcgag
cacgcgggtgaggcgggcgagctgcggctcagcgagctcctggccgagctgccgttcgcg
gtgctggcgagtggttga

DBGET integrated database retrieval system