KEGG   Opitutus terrae: Oter_2209Help
Entry
Oter_2209         CDS       T00689                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ote  Opitutus terrae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Oter_2209
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Oter_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2844938..2847073)
Genome map
AA seq 711 aa AA seqDB search
MLPRFLPIMTALALASSLPAANPSGQPGLAPSANRPPSHLRTSTFQEFHWGVAYYPEHGE
LATLDQDAERMLAAGMNTVRMAEFAWDLMEPEEGRYDFSFFDDAIARLGAKGIRTILCTP
TAAPPRWLSLSHPEILRVDARGVVQRHGSRQHASTASDVYRDYSRKITRAMAEHFANNPN
VIGWQTDNEFNCHFSEDYSAGAAQAWIGFLREKFHDDIAALNRAWGTAFWAQTYARFEDV
PLPAAGQPTHLNPAHRLDYTRFIAWTVARFQHDQVEILRAAQPRWWITHNGMFRLVDYRG
QFGRDLDVLGCDVYPMFTWDPRQRGATQAWALDAARAWTGNFFVPEHQSGPGGQTDYFHD
NPEPGELRRMLYTSFAHGADSVLLFRWRTARFGAEEYWCGVLDHDNVPRRRYAEVAQVGA
ELARVGPALLGTHVAIDTAIAATDFDNTNAHEALHFNLPAPDQVAAELHGHFWRAGYRVG
AVHPGDTLRGLKLYIIPHFTIIDTAWLPQLESWVRDGGVLVIGARAGTKDADNNVTTDLL
PGVLRPLVGATVVEYGRQNAPEQRPLELEIAGKRVLSREWYEQLAPDDGTEVWLRWATRH
QTGTPAATLHRLGKGAVVYVGTYLNGAVGGALVPELAKLAHVLPALAGAPAGVEVVRREA
DDRALWFLINHTEQPQYVTGLPRGRDLVADRDVRDELTLPPRGVAVIRTPR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgctcccccgctttctccccatcatgaccgcgctcgctcttgccagctcgctgccggca
gcaaatccctctggtcagcccggtttggctcccagcgccaatcgcccgccttcgcatctg
cgcacctcaaccttccaggagtttcactggggcgtcgcctattatcccgagcacggcgaa
ctcgccacgctcgatcaggacgccgagcgcatgctcgccgcgggcatgaacaccgtgcgc
atggccgaattcgcgtgggacctcatggagcccgaggaaggtcgctacgatttctctttc
ttcgacgacgcgatcgcccggctcggcgccaagggcattcgcacgatcctgtgcaccccc
actgccgcgccgccgcgctggctgtcgctcagccatccggagatcctgcgcgtcgacgcg
cgaggcgtcgtgcaacgccacggctcgcgccagcacgccagcacggcgagcgacgtttac
cgcgactactcgcgcaagatcacccgcgcgatggccgagcatttcgccaacaacccgaac
gtgatcggctggcagaccgacaacgagttcaactgccatttctccgaggactattccgcc
ggcgccgcccaggcgtggatcggatttctccgcgaaaagtttcacgacgacatcgccgcg
ctgaatcgtgcgtggggcaccgcgttctgggcgcagacctacgcgcgcttcgaggatgtt
ccgctcccggccgccggacagcccacgcacctgaatcccgcacatcgcctcgactatacg
cggttcatcgcgtggaccgtcgcgcgattccagcacgaccaggtcgagattctccgcgcc
gcgcaaccgcgttggtggatcacacacaacggcatgttccggctggtcgactaccgtgga
caattcggccgcgacctcgacgtgctcggctgcgacgtctacccgatgtttacgtgggac
ccgcggcaacgcggcgccacgcaggcctgggcgctcgatgcggcgcgtgcgtggaccggc
aacttcttcgtgccggagcaccagagcggaccgggcggccagaccgattattttcacgac
aaccccgagcccggcgaattgcgccggatgctctacaccagcttcgcgcatggcgcggac
agcgtgctgctgttccgctggcgcaccgcgcgcttcggcgcggaggaatactggtgtggc
gtgctcgaccacgacaacgttccgcgtcgccgctacgccgaggtcgcgcaagtcggggcc
gagctcgcccgtgtcggccccgcgctgctcggcacgcatgtggcgatcgacaccgcgatc
gccgccactgatttcgacaacaccaacgcgcacgaggcgctgcatttcaatctcccggca
cccgaccaggtcgcggcggagctccacggacacttctggcgtgccggttatcgcgtcggc
gccgtgcatccgggcgacacgctccgcgggctgaagctctatatcattccgcatttcacg
atcatcgataccgcgtggctcccgcagctcgagtcgtgggtccgcgacggcggcgtgctg
gtaatcggcgctcgtgccggcacgaaggacgccgacaacaacgtgaccaccgatcttctg
cccggcgtgctgcgtccgctggtcggcgcgacggtcgtcgagtatggccggcaaaacgcg
ccagagcagcgtccgctcgagctcgagatcgctggcaagcgcgtgctttcgcgcgaatgg
tatgaacagctcgcgcctgacgacggcaccgaggtctggctgcgttgggccacgcgtcat
cagaccggcacccccgccgcgacgctgcatcggctcggcaagggcgccgtggtgtatgtg
ggcacgtatctgaacggcgccgtgggcggtgcactcgtgccggagttagccaagctcgcg
catgtgcttccggcgctcgctggtgcgcccgcgggtgtcgaggtcgtccgtcgcgaggcc
gacgaccgcgcgctctggtttctgatcaaccacaccgagcagccgcagtacgtcacgggg
ctcccgcgcggccgcgacctcgtggccgatcgcgacgtgcgtgacgagctcacgctcccg
ccccgcggcgtcgccgtcattcggacaccgcgctga

DBGET integrated database retrieval system