KEGG   Opitutus terrae: Oter_2227Help
Entry
Oter_2227         CDS       T00689                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ote  Opitutus terrae
Brite
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Oter_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2867734..2868882
Genome map
AA seq 382 aa AA seqDB search
MHTFPFLPPLLALAAALNLPSAVAAEAAAAPALKTAADKLFLVGAAVGPGHTSGRDKSGV
AVIEQHFNTITPENAMKWERIHPKPGRYDFKLADQLVEFGQKRGMFIVGHTLMWHSQTPA
WVFEDEAGQPISREALLERLREHVRTVVGRYRGKVHGWDVVNEAIRDEDGTLRTDKPWYA
ILGEEGVFAAFAAAHEADPDAELYYNDYSLDNPVKRAGVIKLAQAIRARGLRIDGIGSQE
HCLLHWPQIEAVDQTYADLKAAGFKAMVTELDVSVLPRPGNYTGAEVSRRQASSRDMDPY
RKGLPAAQQQALAQRYRELFAVFAKHHDTIQRVTLWGVSDADSWLNGWPIRGRTDYALLF
DREDRAKPALAAAVDALQTAQR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcacactttcccttttctccctccgcttctcgctctcgccgccgctctcaacctgccg
agcgcggtggccgcggaggcggccgcggcgcccgcactgaagacggctgcggacaagcta
tttctcgtcggcgcggccgtgggaccgggccacacttccgggcgcgacaaatccggcgtc
gcagtgattgagcagcatttcaacacgatcacgccggagaacgcgatgaagtgggagcgg
attcacccgaagcccggccgctacgatttcaaactggcggaccagttggtcgagtttggg
caaaagcgcgggatgttcatcgtgggccacacattgatgtggcattcacaaacgccggcg
tgggtgttcgaggatgaggccggccagccgatctcccgcgaggcgctgctcgagcgcctg
cgcgagcacgtccgcacggtcgtcggtcgttatcgcggcaaggtccacggttgggatgtg
gtcaacgaggccattcgcgacgaggatggtacgctgcgcaccgacaagccgtggtatgcg
atcctcggcgaggaaggcgtgttcgcggcgtttgcggcggcgcacgaggcggatccggac
gcggagctctactacaacgattactcgctggacaatccggtgaagcgggcgggcgtgatc
aagctggcgcaggcgatccgcgcgcgcgggctgcggatcgacggcatcggttcgcaggag
cactgcctgttgcactggccccagatcgaagccgtggaccagacctacgcggacctgaag
gcggcggggttcaaggcgatggtcacggaactcgatgtgagcgtgctgccacgaccgggc
aactacaccggcgcagaggtgtcgcggcgtcaggcatcctcgcgcgacatggatccttac
cggaagggtttgccggcggcgcagcagcaggcgctggcgcagcgctaccgcgaacttttc
gccgtctttgcgaagcatcacgacacgatccagcgggtgacgctgtggggtgtttcggat
gcggactcctggctcaatggctggccgattcgcgggcgcaccgactacgcgctcttgttc
gaccgcgaggatcgggcgaagccggccctggcagccgcagtcgacgcgctgcaaaccgcg
cagcgatag

DBGET integrated database retrieval system