KEGG   Opitutus terrae: Oter_2301Help
Entry
Oter_2301         CDS       T00689                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ote  Opitutus terrae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ote00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ote00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ote00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2969450..2970649
Genome map
AA seq 399 aa AA seqDB search
MRKLLCVLLCVASSAFAQKWEGLALTPPMGWNSWNTFANHISEKVVRETADAMEKNGMRD
AGYVYIVIDDTWSLRQRDANGSLVADPEKFPSGMKALADYVHAKGFKLGIYSCAGKTTCG
GYPGSWGHEFQDARLWASWGIDYLKYDWCDHGDANAKDAYARMSAALRAAGRPVVFSLCE
WGQNRPWEWAEPIGHLWRTTGDIYDSYDGRKGWESGWKRLLDLQYSLVDSSGAYDGLNKF
AGPGHWNDPDMLEVGNDGLSLAESRAHFSFWCLLAAPLMAGNDVRHMSEEIRAIMTDKEV
IAINQDPAGKQGFRALAEPAKSIEIWVKELSNQEWAVCALNTDTSARELTIDWGRLWTIQ
GKHSVRDVWAKKAVGDTSKPYTVRVESHDVAMFRLTPAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactgctttgtgtgctgctttgcgtcgccagctcggcgttcgcgcaaaagtgg
gagggcctcgcgctgacgccgcccatgggctggaacagctggaacaccttcgccaatcac
atcagcgaaaaggtcgtgcgcgagacggcggatgcgatggagaaaaacggcatgcgcgac
gccggctacgtttacatcgtcatcgatgacacgtggtcgttgcggcagcgcgacgctaac
ggcagcctggtcgcagatcccgaaaagtttcccagcggcatgaaggcgctggccgattac
gtgcacgcgaaaggattcaagctcggcatctacagttgtgcgggcaagacgacgtgcggc
ggttatccgggcagttggggccatgaatttcaggatgcgcggttgtgggcgtcatggggc
atcgactacctcaaatacgactggtgcgatcacggcgatgcgaacgcgaaggatgcctac
gcgcggatgagcgcggcgctgcgcgcggccgggcgtccggtggtgttcagcctctgcgaa
tggggccagaacaggccgtgggaatgggctgagcccatcggccatctgtggcgcacgacg
ggcgatatctacgactcctacgacggccggaagggttgggagtccggctggaagcgattg
ctcgacctgcagtattcgctggtcgacagctcgggcgcttacgatgggttgaacaagttc
gccggaccgggacactggaacgacccggacatgctcgaggtcggcaacgacgggctgtcg
ctggccgagtcgcgcgcgcatttcagcttctggtgcctgctcgccgcgccgctcatggcc
ggcaacgacgtgcggcacatgagcgaggagatccgcgcgatcatgaccgacaaggaggtg
atcgcgatcaaccaggatcccgcgggcaagcagggcttccgcgcgctggccgagccggcg
aaatccatcgagatctgggtgaaggagctgagcaaccaggagtgggcagtgtgcgcgctc
aacaccgacaccagcgcacgggagctcacgatcgattggggccggctctggacgatccag
ggcaagcacagcgtgcgcgacgtctgggcgaagaaagcggtgggcgacaccagcaagccc
tacaccgtgcgcgtcgagtcgcacgacgtggcgatgttccggctcacgccggcgaagtag

DBGET integrated database retrieval system