KEGG   Opitutus terrae: Oter_2556Help
Entry
Oter_2556         CDS       T00689                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ote  Opitutus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oter_2556
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_2556
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oter_2556
Enzymes [BR:ote01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oter_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3288897..3289697
Genome map
AA seq 266 aa AA seqDB search
MSRIAQAFQRAQAQNRAAFIAYLCAGDPNFDTSLAACRAVITSGVDLLELGVPFSDPLAD
GLTNQLAAQRALESGMTAADVFRLVRRIREFSEVPIVFYTYYNLVFAHGIDAYVRAAKEA
GVDGLLTLDLPPEESDEVSAACRAHGVQSVYIVAPTSPAERIAKIAQAATGFIYYVSREG
VTGVQERVAANIPEAVAAIRRHTALPVVVGFGISNREQVRQVAAVADGVVVGSALVNCIR
ENLGSPERITAKLAAVAGDLVAGTKR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgcccaagccttccagcgcgcgcaagcgcagaaccgcgccgccttcatc
gcctatctctgcgcgggtgatccgaatttcgacacctcgcttgcggcgtgccgcgccgtg
atcaccagcggcgtggatctgctcgaactcggcgtgccgttttcggatccgctggcggac
gggttgaccaaccagctggccgcgcagcgcgcgttggagagcggaatgaccgcggccgac
gtgttccggctcgtgcggcgaatccgcgaattcagcgaggtgccgatcgttttctacact
tactacaatctggttttcgcgcacgggatcgacgcctacgtgcgcgccgcgaaagaggcg
ggcgtcgacggactgcttacgctggacctgccgccggaggagtccgacgaggtttccgcc
gcgtgccgcgcgcacggcgtgcagagcgtgtatatcgtggcgccgacctcgccggcggaa
cgcatcgcgaagatcgcgcaggcggcaaccggtttcatctactatgtgtcgcgcgagggc
gtgaccggcgtgcaggagcgggtcgccgccaacattccggaggcggtggcggccatccgg
cggcacacggcgctgccggtggttgtgggttttgggatttcgaaccgtgagcaggtgcgg
caggtcgcggccgtcgccgacggggtggtcgtgggcagcgcgctcgtgaactgcattcgc
gagaacctgggctcgcccgagcggatcaccgcgaagctcgcggcggtggcaggcgatctc
gtcgccggcacgaagcgctga

DBGET integrated database retrieval system