KEGG   Opitutus terrae: Oter_2629Help
Entry
Oter_2629         CDS       T00689                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ote  Opitutus terrae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Oter_2629
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Oter_2629
Enzymes [BR:ote01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Oter_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3371707..3373206
Genome map
AA seq 499 aa AA seqDB search
MAPKLSDYFGEAEIVAVKGSLDRPISGLVLDSRRVVPGNLFFALPGLRADGASFIDEAVN
RGAVAIVTQKMPAHPPGKVTVIQVADARATLARVAQRYYKFPDRDMTVIGVTGTNGKTTV
THLLKHFLNGDQRVGLLGTINYDLGARTVPAYRTTPESLDIYGMMAQMRDAGCRQAVMEV
SSHGIDQQRVAGLQFGAAVFTNLTRDHLDYHKTLDAYFEVKKRLFTGGTGAAPKVAVVNF
DDPYGVTLAASLKREHQSAKLVTFGENLQADVRAENVHLNFTNSTFRLVWPGGTMEIESP
LIGRYNVSNLLAAIAAAWGLGRDPFVFLARLRAFKGVPGRMERIDEGQPYNVLVDYAHTD
DALRNALGMLRAITPGRLFVVFGCGGNRDRTKRPLMVKAVQEFADFAFATADNPRAEPLP
QIFDDMKAGVLAPEKITWIEDRRRAISLALDAAKAGDCLLIAGKGHESYQEFADTVIPFD
DRQVVRELIGIKNLKEARG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaactctccgactatttcggtgaagccgaaatcgtggccgtcaaaggcagc
ctcgaccgcccgatctccgggctcgtgctcgacagccgccgcgtggtgccgggcaacctc
ttctttgcgctgccgggtctgcgcgcggacggcgcgtcgttcatcgacgaggccgtgaac
cgcggcgcggtggcgatcgtgacgcagaagatgccggcgcacccgccgggcaaggtcacg
gtgatccaggtcgccgatgcccgcgcgacgctcgcgcgcgtggcgcagcgttactacaag
ttccccgatcgcgacatgaccgtgatcggcgtcacgggcaccaacggcaagacgaccgtc
acgcacctgctgaagcatttcctcaacggcgaccagcgcgtgggcctgctgggcacgatc
aactacgatctgggcgcccgcacggtgccggcgtatcgcacgacgcccgaatcgctcgac
atctacggcatgatggcgcaaatgcgcgacgccggctgccgccaggcggtgatggaagtc
agctcgcacggcatcgaccagcagcgcgtggccgggctgcagttcggcgcggcggtgttc
accaatctcacccgcgatcatctcgactaccacaagacgctcgacgcgtacttcgaggtg
aagaagcggctgttcaccggcggcaccggtgcggctcccaaggtggcggtggtcaatttc
gacgatccctacggcgttacgctcgccgccagcctgaaacgcgaacaccagtcagccaag
ctggtgacgttcggggaaaacctgcaggccgacgtgcgcgccgagaacgtacacctgaac
ttcaccaacagcacgttccggctggtctggcccggcggcacgatggaaatcgagtcgccg
ctgatcggtcgctataacgtgagcaacctcctggcggcgattgcggccgcgtggggcctg
ggtcgcgatccgttcgtgttcctggcgcggctgcgcgcgttcaagggcgtgcccggccgc
atggagcggatcgacgagggccagccgtacaacgtgctggtcgactacgcgcacaccgat
gacgcgttgcgcaacgcgctcggcatgctgcgcgcgatcacgccgggccggctgttcgtg
gtgttcggttgcggcggcaaccgcgatcgcacgaaacgaccgttgatggtgaaggccgtg
caggagttcgccgatttcgccttcgccaccgccgacaatccgcgcgccgagccgctgccg
cagatcttcgacgacatgaaagccggcgtcctggcaccggaaaaaatcacctggatcgag
gaccgccgccgggcgatcagcctcgcgctcgatgccgcgaaagccggcgattgcctgctg
atcgcgggcaaggggcacgagagttatcaggaatttgccgacactgtgatccccttcgac
gaccgccaggtcgtgcgcgagctgatcgggatcaagaacctgaaggaggccagagggtga

DBGET integrated database retrieval system