KEGG   Opitutus terrae: Oter_2688Help
Entry
Oter_2688         CDS       T00689                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ote  Opitutus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oter_2688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_2688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oter_2688
Enzymes [BR:ote01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oter_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3442609..3443835
Genome map
AA seq 408 aa AA seqDB search
MSSSATTAPHDRFALPDAAGRFGRYGGVFVPETLMTALEELGAAYEAAKKDPDYVAELRR
HLKEFAGRPTELYFAERLTQHCGGAKIYLKREDLLHTGAHKINNALGQALLARRMGKKRI
IAETGAGQHGVATAAVCAKFGLECVVYMGAVDMERQALNVFRMRLMGAEVRSVDSGQKTL
KDAVNEAMRDWVTNVRGTHYILGSALGAHPYPMMVRDFHRVIGQETKEQILAREGRLPDE
MVACVGGGSNAIGFFFEFLDEPKVKLIGVEAGGRGIRRGEHAARFEGGKLGVLQGAKTYI
LQNPDGQIELTHSVSAGLDYAAIGPEHAYYRERNRIEFAYACDDEVIETFQLCSRLEGII
PALESTHALVHGIKRAQQLRPDQIIVINLSGRGDKDVNQVAKMLGVAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctccgccaccaccgctcctcatgatcgcttcgcgttgccggacgccgcgggc
cgattcggccgttacggcggggtgttcgtgccggagacgttgatgacggcgctggaggaa
ctgggcgcagcgtacgaggcggcgaagaaggatccggattacgtggccgagttgcgccgg
cacttgaaggagttcgccggccggcccaccgagctctacttcgctgagcggctcacgcag
cactgcggcggcgcgaagatctacctgaaacgcgaggatctgctccacaccggcgcgcac
aagatcaacaacgcgctcggccaggcgctgctcgcgcggcggatgggaaagaaacggatc
atcgccgagaccggcgccggacaacacggcgtcgcgacggcggcagtgtgcgcgaagttc
ggcctcgaatgcgtcgtctacatgggcgcggtggatatggagcggcaggcactgaatgtt
tttcgcatgcgcctcatgggagccgaagtccggagcgtggactcggggcaaaagacgttg
aaggatgccgtgaacgaggcgatgcgcgactgggtgacgaacgtgcgcggcacgcactac
attctcggttcggcgctcggcgcgcacccgtatccgatgatggtgcgcgattttcaccgg
gtgatcgggcaggagacgaaggaacagattctagctcgcgaggggcggctgcccgacgag
atggtggcctgcgtcggcggcggttcgaacgcgattggtttctttttcgaatttctcgac
gaaccgaaggtgaaactcatcggcgtcgaagcgggtgggcgcggcattcggcggggcgag
cacgcggcgcgtttcgaaggcggcaagctgggtgtcctgcagggcgcgaagacgtacatt
ctccagaatccggacgggcagatcgagctgacgcactcggtcagtgcggggttggactac
gcggcgatcggtcccgaacacgcctactatcgcgagcggaaccggatcgaatttgcctac
gcgtgcgacgacgaggtgatcgagacgttccagctttgttcacgactcgaaggcatcatt
cccgcgctcgagagcacgcatgcgctggtgcacggcatcaagcgggcgcagcagctgcgg
ccggaccagatcatcgtgatcaacctgtccggacggggagacaaggacgtcaatcaagtg
gcgaaaatgctcggcgtggcgttgtag

DBGET integrated database retrieval system