KEGG   Opitutus terrae: Oter_2694Help
Entry
Oter_2694         CDS       T00689                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ote  Opitutus terrae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oter_2694
Enzymes [BR:ote01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Oter_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3449678..3451081)
Genome map
AA seq 467 aa AA seqDB search
MSTSPFNPSATASGRPPKTFAVLGAGITGLTAAHRLTQLGHKVRVFEQSDRVGGSIKTEE
VDGWLIEGGPNTLLSGELAVDKLIDELGLNGERIAADPAAKNRYIVRRGRALAAPMSPPS
FFASSLFSPVAKFKLLAELFARRRVRTTDVSLAEFVESHFGREFVDYALNPFVGGVYAGD
PEKLSARQSFPKLWEIEQTHGSLIRGQIAAAKARKARGEPRPGIFSFKHGLHVLPEALAA
RLPAGAITLGASLDAIVPGDKWNVVWHDDVATHTQSFDSVVVALPAPALARLQIGTLGEK
PLAALALIEHPPVSSLFLGFRREQVAHPLDGFGVLVPAVEKRSVLGVLFSSSLFPGRAPL
GHVALTVMVGGTRQPQLASLPADQLLAAVRPDLTQLLGVSGDPVFVRHNFWPRAIPQYNL
GHEHFIAALAAGERFHPGLFMGGQARDGIAVPACIAAGEKLAERAGQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctcgccttttaatccttccgccaccgcctcaggccggccgcccaaaacgttc
gccgtgcttggcgccggcatcaccgggctcaccgccgcccaccggctcacccagctcggc
cacaaggtgcgcgtgttcgagcaatccgaccgcgtcggcggctcgatcaagacggaggaa
gtcgacggctggctgatcgaaggcggacccaacacgctgctctccggcgaactcgccgtc
gacaagctcatcgacgaactcgggctgaacggcgaacgcatcgccgcggatcccgccgcg
aaaaaccgctacatcgttcgccgcggccgcgcgctggccgcgccgatgtccccaccgtcg
ttcttcgcctcctcactgttttcgcccgtcgccaagttcaagctcctcgccgagctgttc
gcccggcggcgcgtccgcacgaccgacgtcagcctcgccgaattcgtcgagtcgcacttc
gggcgcgagttcgtcgactacgcgctcaatccgttcgtgggcggcgtgtatgccggcgat
cccgaaaagctctccgcgcggcagtcgttccccaagctctgggaaatcgaacaaacccac
ggctcgctgatccgcggccagatcgccgcggccaaagcccggaaggcccgcggtgagccg
cgccccggcatcttttccttcaaacacggcctgcacgtgctgccggaggcgctcgccgcg
cgtctccccgccggcgccatcacactcggcgcttcgctcgacgccatcgtgcccggcgac
aagtggaacgtggtttggcacgacgacgtggcgacgcacacgcaaagcttcgacagcgtc
gtggtcgcgctgcccgcgcccgccctcgcgcgactccagatcggcacgctcggcgaaaag
ccgctcgccgcgctggcgctgatcgaacacccgccggtctcgtcgctcttcctcggcttc
cgccgcgagcaggtcgcgcatccgctcgacgggttcggcgtgctcgtgccggccgtcgag
aagcgctcggtccttggcgtgctgttctcgtcctcgctgttcccgggccgcgcgccgctg
ggacacgtggcgctgacggtgatggtgggcggaacacgccagccgcaactcgccagcctg
cccgccgatcagctgcttgccgccgtgcggcccgatctcacgcagttgctcggcgtcagc
ggcgacccggtttttgtccggcacaacttctggcctcgcgccatcccgcagtacaacctc
ggtcacgagcacttcatcgccgctcttgccgccggcgaacgcttccatccgggactgttc
atggggggacaggcccgcgacgggatcgccgtcccggcctgcatcgcggccggcgaaaaa
ctggcggaacgcgccgggcaatag

DBGET integrated database retrieval system