KEGG   Opitutus terrae: Oter_2744Help
Entry
Oter_2744         CDS       T00689                                 

Definition
(GenBank) peptidase M42 family protein
Organism
ote  Opitutus terrae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3513629..3514699)
Genome map
AA seq 356 aa AA seqDB search
MPKPYTVPPFLSALLHARSPSGYETEAHAVFDRYVKPAADAYENDALGNRRATLNPKGDP
VLMLAGHLDELGLIITYINKDGFLYFDTIGGHDLSVISGRRVVIQTANGIVKGVTGKRAI
HLMDEEDRKKVPKRHEIWIDIGVRSKAEALERVAIGDVATYDHELELINGSIGAARAFDN
KVGAYIVGETLIRLAKANKKLAAKVVAVGTSQEEIGVRGATTAAYAVNPHVAIAIDVGHA
TDHPDCDHRKFGETTLGGGPILCRGANINPKVYQKLLAAAKRVKIPHQFEADPRPTGTDA
RAIQMGRGGVATGLVSIPLRYMHTPSEVVDLEDVERCVQLLVEFAQMIGPRESFNW
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccttacaccgtcccgcccttcctctccgcgctgctccacgctcgttccccg
tccggctacgaaaccgaggcgcacgcggtcttcgatcgctacgtcaaacctgcagccgat
gcctacgagaacgacgcgctcggcaatcgccgcgccacgctgaatccgaaaggcgacccg
gtgctcatgctcgccggccatctcgacgagctcgggctcatcatcacctacatcaacaag
gatggcttcctctatttcgacacgatcggcggccatgacctcagcgtcatttcgggccgg
cgcgtggtgatccaaaccgcgaacggaatcgtcaagggggtcaccggcaagcgcgcgatc
catctcatggacgaggaggatcgcaagaaggtaccgaaacggcatgagatctggatcgat
atcggcgttcgctcgaaagctgaagcgctcgagcgagtcgccatcggagatgtcgccacc
tacgatcacgaactcgagttgattaacggcagcatcggcgccgcgcgggcgttcgacaac
aaggtcggcgcctacatcgtcggcgaaacgctgatccgactggccaaggcgaacaaaaag
ctcgcggcgaaggtcgtcgcggtcggcacctcgcaggaggagatcggcgtgcggggcgcc
accacggccgcctacgcggtgaacccgcacgtcgcgatcgcgatcgatgtcggccatgcg
accgaccatccggattgtgaccatcggaaattcggcgaaacgacgctcggcggtggtccg
attctttgccggggggcgaacatcaatccgaaggtctaccaaaagctcctcgctgccgcg
aaaagggtgaagatcccgcaccagttcgaagccgatccgcgtccgaccggcacggatgcc
cgcgcgatccagatgggccgcggcggcgtcgccaccgggctggtcagcattccgctccgc
tacatgcacacgcccagcgaggtcgtcgatctcgaggacgtggagcgctgcgtgcagttg
ctggtcgagttcgcccagatgatcggcccgcgcgaatcgttcaactggtag

DBGET integrated database retrieval system