KEGG   Opitutus terrae: Oter_2777Help
Entry
Oter_2777         CDS       T00689                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ote  Opitutus terrae
Pathway
ote03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ote00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Oter_2777
DNA repair and recombination proteins [BR:ote03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Oter_2777
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Oter_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim zn-ribbon_14
Motif
Other DBs
NCBI-ProteinID: ACB76058
UniProt: B1ZW44
Position
3550257..3550853
Genome map
AA seq 198 aa AA seqDB search
MPSAFEKLQQQLKQLPGLGYRSSERIALHLLVEKPQRLPALVAALEEAARTVRRCTRCGN
LAEAELCPICADERRDPSLVCVVEEVPDLVALERSGAYRGVYHVLHGKLSPMHGVGPDDL
NVASLLARVESGAVGELILALSNDVEGEATCHYLTEQLKKGKAPQITRIGFGLPSGGGVL
YADSVTLKSALDARRSYS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgccttccgcctttgagaaactccagcagcagctgaagcagctgccgggattgggctat
cgctcctcggaacgcatcgccttgcatctgctcgtggagaaaccgcagcggctgcccgcg
ctcgtggcggcgctggaagaggccgcgcgcacggtgcgtcggtgtacgcgttgcggcaat
ctggccgaagccgagctgtgcccgatctgcgccgacgaacgccgcgacccctcgctggtg
tgcgtcgtcgaggaagtgcccgacctcgtggcgctggagcgcagcggcgcgtatcggggt
gtctatcacgtgctccacggcaaactttcgccgatgcacggagtgggtccggatgacctg
aatgtcgcctcactgttggcgcgggtggagtcgggcgccgtgggcgagttgatcctcgcg
ctctcgaacgacgtcgaaggtgaggcgacgtgtcactatctgactgagcagttgaaaaag
ggaaaagcgccgcagatcacgcggatcgggttcggactgccgagcggtggtggcgtgctc
tacgccgattcagtgacgctcaaaagcgcgctggatgcgcgacggagctactcataa

DBGET integrated database retrieval system