KEGG   Opitutus terrae: Oter_2865Help
Entry
Oter_2865         CDS       T00689                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ote  Opitutus terrae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Oter_2865
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Oter_2865
Enzymes [BR:ote01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Oter_2865
Lipid biosynthesis proteins [BR:ote01004]
 Desaturase
  First
   Oter_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3662817..3663998
Genome map
AA seq 393 aa AA seqDB search
MPFRIPTARINWTNSSFLIGTAFVTCTAVPLYLWHFGLDAFQLTLFLAFVIGTGLSITLG
YHRLFAHIAFQAKWPVRLVTLLFGAAAFENNALAWVSDHRRHHKHVDHDDDPYDISKGFW
HAHIGWILFKLDPEPPWDNVNDLRKDPLVMWQVRWYVPIAVGVGFVLPAALGYLYSGWAG
ALGAFLLAGVARVTAVQHMTFFINSLCHTVGRQPYSDRCSARDSWVMALFTFGEGYHNYH
HEFQHDYRNGVKWWQWDPTKWTIWTLEKLGLVEGLRRVPEEKILLSQLADTRRRLNARLA
SGHPHLNERLRDMLQRSDAKLHQLGERWAALKSEYAAKAGALKAEYAEKAGALKAEYAER
ANTQLAEARAALAEMRREIAAALSLLERAGATT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttcggattcctactgcccgcattaactggacgaatagctcgttcctgatcggg
accgctttcgtcacctgcaccgcggtgccgctttacctctggcacttcggcttggacgcg
tttcagctcaccctgtttctcgcgttcgtcatcggcaccgggctgagcatcacgttggga
tatcatcggcttttcgctcacatcgcgttccaggccaaatggccggtgcgattggtcacg
ctgctgttcggggctgcggcctttgagaacaatgcactcgcgtgggtttccgatcaccga
cggcaccacaagcacgtcgaccacgacgacgatccttatgacatcagcaaggggttctgg
cacgcacacatcggctggatcctcttcaagctcgatcccgagccgccgtgggacaacgtg
aacgatctgcgcaaggacccgctggtgatgtggcaggtgcgttggtacgtgccgatcgcg
gtcggcgtgggtttcgtgctccccgccgcgctgggctacctctactcgggctgggcgggt
gcgctcggagcctttctgctcgcgggggtcgcgcgcgtcaccgcggtgcagcacatgaca
tttttcatcaactccctttgccatacggtcggccggcagccgtattccgaccgctgcagt
gcgcgcgacagctgggtcatggcgctgtttacgtttggcgagggctaccacaactatcac
cacgagtttcagcacgactaccgcaacggcgtgaagtggtggcaatgggatccgaccaaa
tggacgatctggacgctcgagaagctgggactcgtcgaggggctccgccgcgtacccgag
gagaagatccttctctcgcagctcgccgacacgcggcgacgcttgaatgcccggttggcc
agcggccatccgcacctcaacgaacggctgcgcgacatgctccagcggtccgacgcgaaa
cttcatcaactcggcgaacgctgggcggctttgaaatccgaatacgcggccaaggccggg
gcgctgaaggcggaatacgccgagaaggcgggagcgctgaaggccgagtacgcggagcgg
gccaacacgcaattggcggaggcgcgcgcggcgctggccgaaatgcggcgggagatcgcc
gcggcgctctcgctcctcgagcgcgcgggtgcgacgacctag

DBGET integrated database retrieval system