KEGG   Opitutus terrae: Oter_2886Help
Entry
Oter_2886         CDS       T00689                                 

Definition
uroporphyrinogen-III decarboxylase-like protein
Orthology
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
ote  Opitutus terrae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ote00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3684949..3686034)
Genome map
AA seq 361 aa AA seqDB search
MTPKRRILATLNREPVDRTPVDLWHTPEVGAALRQHFGVADDLAAYRALGLDKIVWAFLD
YDGGDTGRVGTLAGAGADDPAATRTMWGVPLRTIQAGAAQYAEFGAAPLLGYDTPGSLDD
YPWWPQLDRVDYNSAVRYVLRAAQDFAVIGPWVSFFEIYCQLRGLEQAMMDLVESPEYVE
ATLDRIEAIQTEMMKRYFTRARGCLDLVFVSDDIAGQRSLLISPAMWRQHLEPRLKRWCD
LIHAHGLKVFYHTDGAARPLIGPILDCGVDVLNPIQHACPGMDLAELKKEFGHRVIFHGA
VDNQTVLPRGTADEVRAEVRECLRTLGAGREGFICCSCHNTQAGTPVENILAMVETVHAC
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactccgaaacgacgtatcctcgccacactcaaccgtgaaccggtcgaccgcacgccc
gtcgatctgtggcacacgccggaagtcggcgccgccctgcggcagcacttcggcgtcgcg
gacgatctcgccgcgtatcgcgcgcttggtctcgacaagatcgtctgggcgttcctcgac
tacgacggtggcgacactgggcgcgtcggcacactcgccggcgccggcgccgacgatccc
gcggcgacgcgcacgatgtggggtgtgcctttgcgcaccatccaggcgggcgcggcccag
tatgccgagttcggtgccgctccgcttctgggctacgacacgccgggctcgctcgacgat
tatccgtggtggccgcagctcgaccgggttgactacaactcggccgtgcgctacgtgctt
cgcgccgctcaggatttcgccgtcatcggaccgtgggtttcgtttttcgagatctactgc
caactccgtggcctcgagcaggccatgatggatctggtcgagtcgcccgaatacgtcgaa
gccacgctcgaccgcatcgaggcgatccagaccgagatgatgaaacgctacttcactcgc
gcgcgcggctgcctcgatctcgtgttcgtcagcgatgatatcgccggccagcgttcactg
ctgatttcccccgccatgtggcggcaacacctggagccgcggctcaaacgctggtgcgat
ctgattcacgcgcacgggctcaaggtcttctaccacaccgacggcgccgcgcgaccgctg
attggtccgattctcgactgcggcgtcgacgtactgaacccgatccaacacgcatgcccg
ggaatggatctggccgagctgaaaaaggagtttggtcaccgcgtgatcttccacggtgcg
gtcgacaaccagacggtgctgccgcgcggcacggcggacgaggtccgcgctgaagtgagg
gagtgcctccgcacgctcggcgccggccgcgagggtttcatctgctgctcgtgccacaac
acccaggccggcacccccgtcgagaacatcctcgcgatggtcgaaaccgtccacgcctgc
ggctga

DBGET integrated database retrieval system