KEGG   Opitutus terrae: Oter_2895Help
Entry
Oter_2895         CDS       T00689                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ote  Opitutus terrae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_2895
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_2895
   00052 Galactose metabolism
    Oter_2895
   00500 Starch and sucrose metabolism
    Oter_2895
   00520 Amino sugar and nucleotide sugar metabolism
    Oter_2895
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oter_2895
   00524 Butirosin and neomycin biosynthesis
    Oter_2895
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oter_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3696294..3697211)
Genome map
AA seq 305 aa AA seqDB search
MTSSLIGIDLGGTKCAVSIPDGDDGVREVARFASDKPAPTLARLFAEIDRLQPGDDVVFG
ISCGGPLDAERGLILSPPNLPGWDRIAICDQLTRRYGGDARLMNDANACALAEWQFGAGR
GTRNMIFLTMGTGMGAGLILDGRLYEGTNGNAGEVGHVRLVPTGPVGYGKPGSFEGFCSG
GGIAQLAHRFWPEALPDQLTAREAATAATLGDPVALRLWHEVGIRLGEALAILVDVLNPE
RIVIGSIFARCEQFIAGGMQESLRREALAPSLAVCSVVPAALGEQIGSHAALAIARCHLR
PVSTP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatctctgattggcatcgatctcggcggcaccaaatgtgccgtgagcattccc
gatggcgacgacggcgtgcgcgaagtggcgcgcttcgcctcggacaaaccggccccgacg
ctcgcacggcttttcgccgagatcgaccggctgcagcccggcgacgacgtcgtgttcggc
atttcctgcggtggtccgctggacgccgagcgcggtctgatcctgtccccgccgaatctc
cccggatgggatcgcatcgcaatctgcgaccaactcacccgccgctacggcggcgatgcc
cgcctcatgaacgacgccaatgcctgcgcgctcgccgagtggcagttcggcgccggccgc
ggtacgcgcaacatgatcttcctcacgatgggcaccggcatgggcgcgggcctcatcctc
gacggacggctctacgaaggcacgaacggcaacgccggcgaagtgggccacgtgcgcctc
gtcccgaccgggccggtcggctacggcaagcccggctcattcgagggcttctgctccggc
ggcggcatcgcgcaactcgcgcaccgcttctggcccgaggccctgccggatcaactcacc
gcccgcgaggccgcgacggccgcgacgctcggcgatcccgtggcactccggctgtggcac
gaagtcggcatccgactcggcgaagcgctcgcgatcctcgtcgatgtactcaatcccgag
cgcatcgtcatcggcagtattttcgcgcgctgcgaacagttcatcgcaggcggcatgcag
gaatccctccgtcgcgaagccctcgccccgagcctcgccgtttgctccgtcgtccccgcc
gcgttgggcgagcagatcggcagccacgccgccctcgccatcgcccgttgtcacctccgc
cccgtttccaccccatga

DBGET integrated database retrieval system