KEGG   Opitutus terrae: Oter_2956Help
Entry
Oter_2956         CDS       T00689                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ote  Opitutus terrae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ote00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3800830..3802149
Genome map
AA seq 439 aa AA seqDB search
MDDYIERLVDLIDPASHRLHNMTIEAARERILNGSPESVREIDGSFAIVAREGKRVRMAR
SLDRPMRYFLAKRREGPALIVADRIDAIHEQLKREGLDRQFHPSYTRMVPAHYVIELQLI
GCPDPDPTYTRYFTPERNALPADLDAIGRAYIGALADEVAKWLRSMPEHEPIGVCFSGGV
DSGAVFVTVYEVMRKLGMNPARLKAFTLDFGDGPDVRQAREFLERLGLGLFLETIEADPA
SLNVADTLRVLEDYKPLDVECASMVLALCRGIRARYPEWRLLVDGDGGDENLKDYPIEEN
PELTIRSVVNNLMLYHEGWGVGRIKHSLTYSGGLSRSYARTYAPARQCGFEDFSPFTRPA
VIAVAEGIPFATLSEMSVDRLYSLKGEVARRGIKVHFGIDLPVFEKRRFQHGAIPVQQLR
ERLNTREADYRRQYHALYQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggacgactatatcgaacggctcgtggatctcatcgatcctgcctcacatcgcctgcac
aatatgaccatcgaagcggcgcgcgagcggatcctcaacggctcgcccgagtcggtgcgc
gaaatcgacggttcgttcgcgatcgtcgcgcgcgagggcaagcgcgtgcggatggcgcgc
tcgctcgaccggccgatgcgctacttcctcgccaaacgccgcgagggtccggcgctgatc
gtcgccgatcggatcgacgcgatccacgagcagttgaaacgcgaaggactcgaccggcaa
tttcacccgagctacacgcgaatggtcccggcgcactacgtgatcgagctgcagctcatc
ggctgcccggatcccgatcccacctacacgcggtatttcacgccggagcgcaacgcgctg
ccggccgacctcgacgcgattggccgggcctacatcggcgcgctggccgacgaggttgcg
aaatggctccgcagcatgcccgagcacgagccgattggcgtgtgcttctcgggcggcgtc
gatagcggcgccgtgttcgtgaccgtctacgaagtgatgcggaagctcgggatgaatccc
gcgcgactgaaggcattcacgctcgacttcggcgacgggccggatgtccggcaggcgcgg
gagtttttggagcgactcgggctcggactgttcctggagacgattgaggcggatccggct
tcgctgaacgtcgcggacacgctgcgggtcctggaggattacaagccgctcgatgtcgaa
tgcgcttcgatggtgctggcgttgtgccgcggcatccgcgcgcgttatccggagtggcgg
ctgctcgtcgatggcgacggtggcgacgagaatctgaaggactatccgatcgaggagaat
ccggagctcacgatccgcagtgtcgtcaacaatctcatgctctaccacgaaggctggggc
gtcggtcggatcaaacactcgctgacttacagcggcgggctgagccgcagctacgcgcgg
acctatgcgccggcgcggcagtgcgggttcgaagacttcagtccgtttacgaggccggcc
gtgatcgcggtggccgaaggcattcccttcgccacgctgagcgagatgtcggtggaccga
ctctactcgttgaaaggcgaggtcgcgcggcgcgggatcaaggtacatttcggcatcgac
ctgccggtgttcgaaaagcggcggttccagcacggcgcgattccggtgcagcagctgcgc
gagcggctcaacactcgcgaagccgattaccggcgacagtatcacgcgctgtaccaatag

DBGET integrated database retrieval system