KEGG   Opitutus terrae: Oter_3554Help
Entry
Oter_3554         CDS       T00689                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ote  Opitutus terrae
Pathway
ote00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01130  Biosynthesis of antibiotics
ote01230  Biosynthesis of amino acids
Module
ote_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oter_3554
Enzymes [BR:ote01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Oter_3554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ACB76831
UniProt: B1ZW79
Position
4628196..4628996
Genome map
AA seq 266 aa AA seqDB search
MPDKLIEIMAHKRREIAPLIRPVTETELAQLDASRPKPPSFADALRRPDGTLAVISEIKR
RSPSAGEIKAGASAVEQARRYRAAGADALSILTDTEFFGGTLADLSDVTTEFRDQRPAPP
CLRKDFMVHPVQVAQAREAGASAILIIVRALDDAEIQALYSAAQAAGLDALFEVHHETEL
ERALHHRARIIGVNNRDLAVFKTDLALSERLIPQFPRDVIAVSESGIFTGADARRVHAVG
AHAVLVGEALMKAPDPAALIAEFRAR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaagctcatcgagatcatggcgcacaagcggcgcgaaatcgccccgctgatt
cgtccggtcaccgagaccgagctcgcgcagctcgacgcctcgcggccgaagccgccttcg
ttcgccgacgccctgcgccggcccgacggtacgctggccgtgatctccgagatcaaacgc
cgctcgccgtccgccggcgagatcaaggccggtgcgtccgcggtcgagcaggcccgccgc
taccgagccgccggcgccgacgcgctctcgattctcaccgacacggaattcttcggcggc
acgctcgccgacttgagcgacgtcacgaccgagttccgggaccaacgtcccgcgccgcca
tgtctgcgcaaggatttcatggtgcatccggtgcaggtcgcgcaggcgcgcgaggccggc
gcctccgccatcctgatcattgtgcgcgcgctggatgacgccgagattcaggccctgtac
agcgccgcccaagcggccggattggacgcgctgttcgaggttcaccacgaaaccgagctc
gagcgcgccctgcatcatcgcgcgcggatcattggcgtgaacaatcgcgacctcgccgtc
ttcaagaccgacctggcgctcagcgaacggctgatcccgcaattcccgcgcgacgtgatc
gccgtgagtgaaagcggcatcttcacgggcgccgacgcgcggcgcgtgcacgccgtcggc
gcgcacgccgtgctcgtcggcgaagcgctcatgaaagcgcccgatcccgccgcgctgatc
gccgagttccgcgcgcgttga

DBGET integrated database retrieval system