KEGG   Opitutus terrae: Oter_3825Help
Entry
Oter_3825         CDS       T00689                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ote  Opitutus terrae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_3825
   01230 Biosynthesis of amino acids
    Oter_3825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_3825
   00051 Fructose and mannose metabolism
    Oter_3825
   00562 Inositol phosphate metabolism
    Oter_3825
Enzymes [BR:ote01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Oter_3825
Exosome [BR:ote04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Oter_3825
  Exosomal proteins of bladder cancer cells
   Oter_3825
  Exosomal proteins of melanoma cells
   Oter_3825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4968991..4969761)
Genome map
AA seq 256 aa AA seqDB search
MIPRKKLIAGNWKMNKTPADGVALVKEIVAAAGKNNDVDMVVCPPFVAIESVGKALEGSN
VKLGAQNMHPEASGAFTGEVSAPMLRAVFATHVILGHSERRAYFAETDAFINKKVLAALK
NQLKPILCVGETLAEREAGSTLKVVQTQLEGGLEGVSKEQAATVVIAYEPVWAIGTGKVA
TTDQAQEVHAFIRGLLVKLFGDAIAAKVRILYGGSMKPSNAPELLAQKDIDGGLIGGAAL
EARSFLELINAAAAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattccccgcaaaaagctgatcgctggtaactggaagatgaacaagacgcccgccgac
ggtgtggcgctggtcaaggaaatcgtcgccgctgccggcaagaacaacgacgtcgacatg
gtggtgtgcccgccgtttgtcgcgatcgagtccgtgggcaaggccctcgaaggctcgaac
gtgaaactcggcgcgcagaacatgcaccccgaggcgagtggcgctttcaccggcgaagtc
tcggctccgatgctccgcgccgtgttcgcgacgcacgtgatcctgggccacagcgagcgc
cgcgcctacttcgcggaaaccgatgccttcatcaacaagaaggtcctcgccgcgctgaag
aaccagttgaagccgatcctctgcgtgggcgagacactcgccgagcgcgaggcgggctcg
acgttgaaggtcgtgcagacgcagcttgaaggcggactcgagggcgtgagcaaggagcag
gcggccacggtcgtgatcgcctacgagcccgtgtgggcgatcggcaccggcaaggtggcg
acgaccgaccaggcacaggaagtgcacgcgttcatccgcggcttgctcgtgaagctgttt
ggcgacgccatcgcggcgaaggtacggatcctgtatggtggttcgatgaagccgtcgaac
gcgcccgagctcctcgcgcagaaggacatcgacggtggtctgatcggcggcgccgcgctc
gaagcgcgcagcttcctcgagctgatcaacgccgccgcggcgatcaagtaa

DBGET integrated database retrieval system