KEGG   Opitutus terrae: Oter_4191Help
Entry
Oter_4191         CDS       T00689                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ote  Opitutus terrae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_4191
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oter_4191
  Amino acid metabolism
   00310 Lysine degradation
    Oter_4191
Enzymes [BR:ote01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Oter_4191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5417421..5418752
Genome map
AA seq 443 aa AA seqDB search
MPNLEVKIPPMGESIISGVLAKWHVNNGDVVQKDQPLFELETDKITSEGTAEAAGRITLS
VEAGAEVKIGQVVATIDTAAAGAATPSSRPAPGATATGQDGTPTSALPNPYAPPGTAQAA
SAIAKSPGAGAGQPTPAPKSLGTESPAVRRLAAETGVDPAKVSGTGKAGRVTKGDMLAAA
ESKSAAPTIVAGVADPGPGSPSPATTASSRAQRQTRRKMSPLRQKIAQRLVAAQQEAAML
TTFNEVDMSHVMVLRAKYQDDFVKRHGIKLGFMSFFLKAAVHALREVPAVNAQIDGDSIV
ENHFYDIGVAVSTDRGLMVPVIRDCDTIGMADMEKQIATAATKARDGKITLADLEGGVFT
ITNGGIFGSMLSTPIINPPQSAILGMHAINERPVAVNGQVVIRPMMYLALSYDHRLVDGK
QAVTFLVRVKQAIEDPTRLVLGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacctcgaagtcaaaatccccccgatgggcgaatcgatcatctccggcgtgctc
gccaagtggcacgtgaacaacggcgacgtcgtgcagaaggatcaaccgctgttcgagctc
gagaccgacaagatcacgtccgaaggcaccgccgaggcggccggccggatcacgctctcg
gtcgaggccggggccgaggtgaagatcggccaggtcgtcgcgacgatcgacaccgccgct
gctggtgccgcgacgccctcgtcgcggccggcgccgggcgcgactgccaccggccaggac
ggcacgcccacctccgccctgccgaatccctacgccccgccgggcaccgcccaagcggcg
agtgccattgcgaaatcgccgggtgccggcgcaggtcagccaacccccgcgccgaaatcg
ctcggcacggaatcacccgccgtccggcggctcgccgcggaaaccggcgtggatcccgcg
aaggtctccggcaccggcaaggccggccgcgtcaccaagggcgacatgctcgctgctgct
gagtccaaatcagcggccccaaccattgtagccggggtcgccgaccccggaccgggctca
ccgagcccggctacaaccgcttcctcgcgggcccaacgccagacccgccgcaagatgtcg
ccgctccgtcagaagatcgcgcagcgactcgttgccgcgcagcaggaggcggccatgctc
accacgttcaacgaggtcgacatgtcgcacgtcatggtgctgcgcgcgaaatatcaggac
gacttcgtgaaacgccacgggatcaagctcgggttcatgtcgttcttcctgaaagccgcc
gtgcacgcgctgcgcgaagtgcccgcggtcaacgcccagatcgacggcgacagcatcgtc
gaaaaccatttctacgacatcggcgttgccgtctcgacggatcgcggcctgatggtgccg
gtcatccgcgactgcgacacgatcggcatggcggacatggaaaaacaaatcgcgaccgcc
gcgaccaaagcccgcgacggcaagatcacgctcgccgatctcgagggcggcgtgttcacc
atcaccaacggcggcatcttcggctcgatgctttcgacgccgatcatcaatccgccgcag
agcgccatcctcggcatgcacgcgatcaacgagcggccggtcgcggtgaacggtcaggtc
gtgatccggccgatgatgtatctcgcgctcagctacgatcaccggttggtcgacggcaaa
caggccgtcaccttcctcgtgagagtgaaacaagccatcgaggatcccacccggctggtc
ctcggcatctga

DBGET integrated database retrieval system