KEGG   Opitutus terrae: Oter_4233Help
Entry
Oter_4233         CDS       T00689                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ote  Opitutus terrae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oter_4233
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oter_4233
   00640 Propanoate metabolism
    Oter_4233
   00660 C5-Branched dibasic acid metabolism
    Oter_4233
Enzymes [BR:ote01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Oter_4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5458831..5460012
Genome map
AA seq 393 aa AA seqDB search
MNIHEYQAKALFEKFGVLVPKGAPAKTPEEFVTALAQLPEGMIVVKSQIHAGGRGKGTFT
DGFKGGVKVCKSKAEAREAAGKMLGNTLVTAQTGPAGRKVQTIYFNVGSQIKKEYYLAIL
LDRATSRPVIVASTEGGMEIEKVAHDTPDRIFKVHVDPAYGLADFQVRELVFKLGFTAAE
GKNASKLIRALYRCFWENDASMVEVNPLITTPDGQVEALDAKVAFDDNALFRHPELVELR
DLNEEDPKEIEASKHELNYIALDGNIACLVNGAGLAMSTMDIIKHFGGTPANFLDVGGGA
SREQVVAAFKIILGDKNVRGILVNIFGGIMDCNVIAQGIVDAVKEVGLELPLVVRLEGNN
VAAGKATLATSGLKLVSGDSMADAAQKIVKLVA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcaggcgaaagcgcttttcgaaaaattcggggttctggtcccg
aagggagcgccagccaagacgccggaagaatttgtcactgcgctcgcccaactccccgag
ggcatgatcgtggtcaaatcgcagatccacgccggcgggcgtggcaagggcacgtttacc
gacggcttcaagggcggcgtcaaggtctgcaagtccaaggccgaagcccgcgaggccgcc
ggcaaaatgctgggcaacacgctcgtcaccgcgcaaaccggccccgccggacgcaaggtc
cagacgatctacttcaatgtcggcagccagatcaaaaaggaatactacctcgcgatcctg
ctcgaccgcgcgacctcgcgcccggtgatcgtcgcctcgacggaaggcggcatggaaatc
gagaaggtggcgcatgacacgcccgatcggattttcaaggtccacgtcgatccggcctac
ggcctggccgacttccaggtgcgcgagctggtcttcaagctcgggttcacggccgcggaa
gggaagaacgcgagcaagctgattcgcgccctgtatcggtgcttctgggaaaacgatgcg
tcgatggtcgaggtcaacccgctcatcaccacgcccgacggccaggtcgaggcgctcgat
gcgaaggtcgccttcgacgacaacgcgctcttccggcatcccgaactcgtggaactccgt
gatctcaacgaggaggacccgaaggaaatcgaggcctcgaaacacgagctcaactacatc
gcgctcgacggcaacatcgcctgcctggtcaacggcgcgggcctggccatgagcacgatg
gacatcatcaagcatttcggcggcacgcccgcgaacttcctcgacgtcggcggcggcgcc
tcgcgcgaacaggtcgtcgctgcgttcaagatcattctcggcgacaaaaacgtccggggc
atcctcgtaaacatcttcggcggaatcatggactgcaacgtgatcgcgcagggcatcgtc
gatgccgtgaaggaagtcggcctcgaactgccgctggtcgtgcggctcgaggggaacaac
gtggcggcgggcaaggccaccctggccacgtccggcctgaagctcgtctccggcgactcg
atggccgacgccgcacagaaaatcgtgaagctggtcgcctag

DBGET integrated database retrieval system