KEGG   Opitutus terrae: Oter_4273Help
Entry
Oter_4273         CDS       T00689                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ote  Opitutus terrae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Oter_4273
   00500 Starch and sucrose metabolism
    Oter_4273
Enzymes [BR:ote01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Oter_4273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5532206..5533921
Genome map
AA seq 571 aa AA seqDB search
MNRFSRSLFVLALLASVFTAVGSAKPDAIVAPDGSGQFTSLQDAISAAPMRTDPAAPAWV
ILVKPGTYRERIYVQRERGNIHVLGEDATTTIVSYDLHANLPGPDGKPIGTFRTPTLQID
GDGMIWENITIANSAGPVGQALALRADGDRLVFRHCRFLGWQDTLLLNRGRHYFVDCTIE
GHVDFIFGAATAFFDHCAIRCLRDGYITAASTPKGAAHGFVFADCTITGAEGVKTYLGRP
WRDFAQTVFLRTEMSAAVRPEGWHNWNKPHAEQTTFYAEFGSTGPGANPSARVAWAHTLT
AEDAADLTPAHVLGGADGWDPVAGAERASVSRESPTTSATTTDAAPPPRRPGITRIVLVG
DSTVTDRSGWGRGFKQLLGPGAECINTALGGRSSKSFRGEGHWEPALALRGDYYLIQFGH
NDQPGKGPKRETDPDTTFAQNLARYVDEVRAIGAEPVLLTSLTRRNFDPANPGRILSTLT
PYANAAKRVAREKAVPLIDLHARSIALCEAWGPERTAALNPRKPNSQDPDTTHLDANGST
IFAQLVVDDLRQAVPALAFILQTAPQPGNRP
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttctcccgctctctcttcgttctcgccttgctcgcttccgttttcaccgcg
gttggctcggccaagcccgacgcgatcgtcgcccccgacggctccggccagttcacctcg
ctgcaggacgcgatcagcgcggcgccgatgcgcactgacccggccgcaccggcgtgggtg
attctggtcaagcccggcacctatcgcgagcgcatctacgtgcagcgcgagcgcggcaac
atccacgtgctcggcgaggacgcgacgacgacgatcgtgagctacgatctgcacgccaat
ctccccggccccgacggcaagccgatcggcacgttccggacgccaacgctccagatcgac
ggcgatggcatgatttgggaaaacatcaccatcgcgaactccgccgggccggtcggtcag
gcgctcgcgctccgcgcggacggcgatcgactggtgtttcgccactgccgtttcctcggc
tggcaggacacgctcttgctcaaccgcggccggcattatttcgtcgactgcaccatcgaa
ggccacgtcgatttcattttcggcgcggccaccgcgttcttcgatcactgcgccattcgc
tgcctccgcgacggctatatcaccgccgcgtcgacgccgaagggcgccgcgcacggcttt
gtctttgcggactgcaccatcaccggcgctgaaggggtgaagacctacctgggccggccg
tggcgtgattttgcccaaaccgtttttctccggaccgagatgtcggccgcggtccgcccg
gagggctggcacaactggaacaagccccacgcggaacaaaccacattctatgccgagttc
ggcagcaccggtccgggcgcaaatccgtcggctcgcgtggcctgggcgcacacactcacc
gccgaggatgcggctgatctgacgccggcgcacgtgctcggtggcgccgatggctgggat
ccggttgccggagcggaacgcgcgagcgtttcacgcgaaagtcctacgacgtctgctacg
acgacggatgctgcccctccgccgcgtcggcccgggatcacgcgcatcgttcttgtcggc
gattccacggtgacggatcgctccggctggggccgcgggttcaagcagttgctcgggccc
ggcgccgaatgcatcaacaccgcgctcggcggccgcagctcgaaaagtttccgcggcgaa
ggccattgggaacccgcgctcgcgctgcgcggcgactactacctcattcaattcggtcac
aacgaccagccgggcaagggcccgaagcgcgagaccgatccggatacgacgttcgcgcag
aacctcgcccgctatgttgacgaagttcgcgcgattggcgccgagccggtgctgttgact
tcgctcacgcgtcgcaacttcgatccggcgaatccgggtcgcatcctctcgacgctcacg
ccctacgccaacgccgcgaaacgagtcgcccgcgagaaggccgtgccgttgatcgacctg
cacgcgcgcagcatcgcgttgtgcgaagcctggggaccggaacgaaccgccgcgctgaat
ccccgcaaacccaacagccaggatcccgacaccactcatttggacgcgaatggcagcaca
atcttcgcgcagctcgtggtcgatgacctgcggcaagccgtgccggcgctcgccttcatt
ctccaaaccgcgccgcagcccggaaatcggccttga

DBGET integrated database retrieval system