KEGG   Opitutus terrae: Oter_4273Help
Entry
Oter_4273         CDS       T00689                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ote  Opitutus terrae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ote00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ote00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5532206..5533921
Genome map
AA seq 571 aa AA seqDB search
MNRFSRSLFVLALLASVFTAVGSAKPDAIVAPDGSGQFTSLQDAISAAPMRTDPAAPAWV
ILVKPGTYRERIYVQRERGNIHVLGEDATTTIVSYDLHANLPGPDGKPIGTFRTPTLQID
GDGMIWENITIANSAGPVGQALALRADGDRLVFRHCRFLGWQDTLLLNRGRHYFVDCTIE
GHVDFIFGAATAFFDHCAIRCLRDGYITAASTPKGAAHGFVFADCTITGAEGVKTYLGRP
WRDFAQTVFLRTEMSAAVRPEGWHNWNKPHAEQTTFYAEFGSTGPGANPSARVAWAHTLT
AEDAADLTPAHVLGGADGWDPVAGAERASVSRESPTTSATTTDAAPPPRRPGITRIVLVG
DSTVTDRSGWGRGFKQLLGPGAECINTALGGRSSKSFRGEGHWEPALALRGDYYLIQFGH
NDQPGKGPKRETDPDTTFAQNLARYVDEVRAIGAEPVLLTSLTRRNFDPANPGRILSTLT
PYANAAKRVAREKAVPLIDLHARSIALCEAWGPERTAALNPRKPNSQDPDTTHLDANGST
IFAQLVVDDLRQAVPALAFILQTAPQPGNRP
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttctcccgctctctcttcgttctcgccttgctcgcttccgttttcaccgcg
gttggctcggccaagcccgacgcgatcgtcgcccccgacggctccggccagttcacctcg
ctgcaggacgcgatcagcgcggcgccgatgcgcactgacccggccgcaccggcgtgggtg
attctggtcaagcccggcacctatcgcgagcgcatctacgtgcagcgcgagcgcggcaac
atccacgtgctcggcgaggacgcgacgacgacgatcgtgagctacgatctgcacgccaat
ctccccggccccgacggcaagccgatcggcacgttccggacgccaacgctccagatcgac
ggcgatggcatgatttgggaaaacatcaccatcgcgaactccgccgggccggtcggtcag
gcgctcgcgctccgcgcggacggcgatcgactggtgtttcgccactgccgtttcctcggc
tggcaggacacgctcttgctcaaccgcggccggcattatttcgtcgactgcaccatcgaa
ggccacgtcgatttcattttcggcgcggccaccgcgttcttcgatcactgcgccattcgc
tgcctccgcgacggctatatcaccgccgcgtcgacgccgaagggcgccgcgcacggcttt
gtctttgcggactgcaccatcaccggcgctgaaggggtgaagacctacctgggccggccg
tggcgtgattttgcccaaaccgtttttctccggaccgagatgtcggccgcggtccgcccg
gagggctggcacaactggaacaagccccacgcggaacaaaccacattctatgccgagttc
ggcagcaccggtccgggcgcaaatccgtcggctcgcgtggcctgggcgcacacactcacc
gccgaggatgcggctgatctgacgccggcgcacgtgctcggtggcgccgatggctgggat
ccggttgccggagcggaacgcgcgagcgtttcacgcgaaagtcctacgacgtctgctacg
acgacggatgctgcccctccgccgcgtcggcccgggatcacgcgcatcgttcttgtcggc
gattccacggtgacggatcgctccggctggggccgcgggttcaagcagttgctcgggccc
ggcgccgaatgcatcaacaccgcgctcggcggccgcagctcgaaaagtttccgcggcgaa
ggccattgggaacccgcgctcgcgctgcgcggcgactactacctcattcaattcggtcac
aacgaccagccgggcaagggcccgaagcgcgagaccgatccggatacgacgttcgcgcag
aacctcgcccgctatgttgacgaagttcgcgcgattggcgccgagccggtgctgttgact
tcgctcacgcgtcgcaacttcgatccggcgaatccgggtcgcatcctctcgacgctcacg
ccctacgccaacgccgcgaaacgagtcgcccgcgagaaggccgtgccgttgatcgacctg
cacgcgcgcagcatcgcgttgtgcgaagcctggggaccggaacgaaccgccgcgctgaat
ccccgcaaacccaacagccaggatcccgacaccactcatttggacgcgaatggcagcaca
atcttcgcgcagctcgtggtcgatgacctgcggcaagccgtgccggcgctcgccttcatt
ctccaaaccgcgccgcagcccggaaatcggccttga

DBGET integrated database retrieval system