KEGG   Orientia tsutsugamushi Boryong: OTBS_0140Help
Entry
OTBS_0140         CDS       T00531                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OTBS_0140 (tpiA)
   01230 Biosynthesis of amino acids
    OTBS_0140 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OTBS_0140 (tpiA)
   00051 Fructose and mannose metabolism
    OTBS_0140 (tpiA)
   00562 Inositol phosphate metabolism
    OTBS_0140 (tpiA)
Enzymes [BR:ots01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OTBS_0140 (tpiA)
Exosome [BR:ots04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OTBS_0140 (tpiA)
  Exosomal proteins of bladder cancer cells
   OTBS_0140 (tpiA)
  Exosomal proteins of melanoma cells
   OTBS_0140 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134361..135110
Genome map
AA seq 249 aa AA seqDB search
MESIVVSNWKMHFSFSEACNYLNLITSLHGNLNIAKVIFAVPNLYLSGLKLKFNDTYHFS
AQDVSMITESSGPYTGEISASMLKNLNVNYAIVGHSERRLLFYEDANTIASKVRNCINNA
IVPIVCIGEPIEARKNKTYLQYIAQQLSSISFSFTKNIIIAYEPVWSIGSCMVPTIDDIY
EVVTMIREIQNRYIPHNIENSVKIVYGGSVSANNINQILTAGIDGVLIGKASLKLESLTT
IIKTVQGLD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaattgtagtttctaattggaaaatgcactttagtttttctgaagcttgcaat
tacctaaatttaataactagcttacatggcaatttaaatattgctaaagtgatatttgct
gtaccaaatttatatttatctgggcttaaattaaaatttaatgacacatatcatttctca
gctcaagatgtaagcatgattacagaaagtagtggcccatatactggtgagataagtgct
agtatgttgaaaaacttaaatgtgaactatgctatagtaggacactcagaacgaaggtta
ttattttatgaggatgctaatacaatagcatcaaaagtaagaaattgtatcaataatgca
atagttccaattgtctgtataggagaaccaattgaagcacgaaaaaataaaacatatctt
caatatatagctcaacagttaagtagtatatcttttagttttactaagaatattattatt
gcttatgagccagtatggtcaattggcagctgtatggttcctaccattgatgatatttat
gaggtagtaactatgattagagaaatacaaaataggtatatacctcataatattgaaaat
agtgttaaaatagtatatggtggttctgtttcagctaataatattaaccaaattctaaca
gctggcattgatggagtattaattggtaaagcatctttaaaattagaaagtttaactaca
ataataaaaacagttcaaggtttagattaa

DBGET integrated database retrieval system