KEGG   Orientia tsutsugamushi Boryong: OTBS_0140Help
Entry
OTBS_0140         CDS       T00531                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
ots00010  Glycolysis / Gluconeogenesis
ots00051  Fructose and mannose metabolism
ots00562  Inositol phosphate metabolism
ots01100  Metabolic pathways
ots01110  Biosynthesis of secondary metabolites
ots01120  Microbial metabolism in diverse environments
ots01130  Biosynthesis of antibiotics
ots01200  Carbon metabolism
ots01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OTBS_0140 (tpiA)
   00051 Fructose and mannose metabolism
    OTBS_0140 (tpiA)
   00562 Inositol phosphate metabolism
    OTBS_0140 (tpiA)
Enzymes [BR:ots01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OTBS_0140 (tpiA)
Exosome [BR:ots04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OTBS_0140 (tpiA)
  Exosomal proteins of bladder cancer cells
   OTBS_0140 (tpiA)
  Exosomal proteins of melanoma cells
   OTBS_0140 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Ribul_P_3_epim Invasin_D3
Motif
Other DBs
NCBI-ProteinID: CAM79206
UniProt: A5CC41
Position
134361..135110
Genome map
AA seq 249 aa AA seqDB search
MESIVVSNWKMHFSFSEACNYLNLITSLHGNLNIAKVIFAVPNLYLSGLKLKFNDTYHFS
AQDVSMITESSGPYTGEISASMLKNLNVNYAIVGHSERRLLFYEDANTIASKVRNCINNA
IVPIVCIGEPIEARKNKTYLQYIAQQLSSISFSFTKNIIIAYEPVWSIGSCMVPTIDDIY
EVVTMIREIQNRYIPHNIENSVKIVYGGSVSANNINQILTAGIDGVLIGKASLKLESLTT
IIKTVQGLD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaattgtagtttctaattggaaaatgcactttagtttttctgaagcttgcaat
tacctaaatttaataactagcttacatggcaatttaaatattgctaaagtgatatttgct
gtaccaaatttatatttatctgggcttaaattaaaatttaatgacacatatcatttctca
gctcaagatgtaagcatgattacagaaagtagtggcccatatactggtgagataagtgct
agtatgttgaaaaacttaaatgtgaactatgctatagtaggacactcagaacgaaggtta
ttattttatgaggatgctaatacaatagcatcaaaagtaagaaattgtatcaataatgca
atagttccaattgtctgtataggagaaccaattgaagcacgaaaaaataaaacatatctt
caatatatagctcaacagttaagtagtatatcttttagttttactaagaatattattatt
gcttatgagccagtatggtcaattggcagctgtatggttcctaccattgatgatatttat
gaggtagtaactatgattagagaaatacaaaataggtatatacctcataatattgaaaat
agtgttaaaatagtatatggtggttctgtttcagctaataatattaaccaaattctaaca
gctggcattgatggagtattaattggtaaagcatctttaaaattagaaagtttaactaca
ataataaaaacagttcaaggtttagattaa

DBGET integrated database retrieval system