KEGG   Orientia tsutsugamushi Boryong: OTBS_0395Help
Entry
OTBS_0395         CDS       T00531                                 

Gene name
recD_traA
Definition
helicase RecD/TraA, ATP-dependent exoDNAse (exonuclease V) (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ots00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OTBS_0395 (recD_traA)
Enzymes [BR:ots01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OTBS_0395 (recD_traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(373703..375898)
Genome map
AA seq 731 aa AA seqDB search
MSVLSYSTKASPIHNQSLAGLVERVTFHNTDNGFCIIKVKVNHKKDLITVIGNSATISSG
QHIEASGIWVNDKEYGLQFKAYTLKVSVPTSIEGIEKYLASGLIKGIGPIYAKKLVQTFG
LDVLTVIENQDPALKKVPGIGPIRAKKIWESWNSQKIISDIMLFIHNYNIGASKAVKIYK
AYGAEAINIIKSNPYQLVSDIKGIGFKSADNIAKAIGIPENSMMRARAGLNYALVTAMGN
GSCGMPTDKLINLCHELLNIDVSIIIDALSFEINERNVAVENINGEECIFLKGLAYAELK
IAELLVHISKGKLAWNPISSNKITEYISNANIKLSPSQQDALNQALKSKVMIITGGPGVG
KTTLINSIINILKSEGVVILLAAPTGRAAKRLSEATQHPAHTIHRLVYSRPGQDVRTITK
LKCQLLILDEMSMVDVTTMYAAISALPSTAALFLVGDIDQLPSVGPGQVFSDLIKSQKFP
IVTLTEIFRQNNQSSIISNAHRINNGFFPILQSSQNSNNDFYFINSDTPEDAIDKITELV
QVRLPKKFSISPFTDIQILSPITRGIVGTKNLNSVLQKVLLPSNSANDELLIWGNIFKIG
DKVMQVVNNYDKDIYNGDIGIINTIDHENQNIVINFDGNKISYDFDEIDEIVLAYAITIH
KSQGGEYHTVIIPLMMQHYPMLQRKLIYTAITRAKKLVIVVGQKKALNIAIKKNIAELRY
SMLKKKLMDIT
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattgtcttattctacaaaagcctcgcctatccataatcaaagtttagcagga
ttagtagaaagagtaacttttcataatactgacaatggattttgtatcattaaagttaaa
gtcaatcataagaaagacttaataacagtaattggcaacagtgcaactatttcatccgga
cagcatattgaagctagcggcatatgggttaatgataaagaatatggcctgcagtttaaa
gcttatacattaaaagtttcagtaccaacaagtatagagggtatagaaaaatatttagca
tctggattgattaaaggcattggtccgatatatgctaaaaaattagtccaaacatttggc
ttagatgttcttacagttattgaaaatcaagatccagcattaaaaaaggtgccaggaata
ggtccaattcgtgctaaaaaaatttgggaaagttggaatagtcagaaaattataagtgat
ataatgctgtttattcataactataatattggcgctagtaaagctgttaaaatatataag
gcttatggagcagaagcaataaatattatcaaatctaatccctatcaattagtatcagat
attaaaggcatagggtttaaaagtgcagataacattgcaaaagctattggtattccagaa
aattcaatgatgagagcgcgagctgggctaaattatgccttagttacagccatgggtaat
ggcagttgtggtatgccaactgataagctaattaatctatgtcatgagttgttaaatatt
gatgttagcattataattgatgcactatcctttgaaatcaatgaacgaaatgttgctgtt
gaaaacataaatggtgaagaatgtatatttcttaagggattagcttatgctgagcttaaa
atagcagaattattagtccatattagtaaaggtaaactagcatggaatccaatcagcagc
aataaaataacagaatacataagcaatgcaaacatcaaactatcacctagtcagcaagat
gctcttaatcaagctttgaagtctaaagtaatgattattactggaggacctggagttggt
aaaactactttaatcaattccataattaatattctaaaaagtgaaggagttgtaatattg
cttgctgctccaactggcagagcagcaaagaggttaagcgaagctactcaacatcctgct
catactattcatcgtttagtatatagtcgtccaggacaagatgtacgaacaattacaaaa
ctcaaatgtcagttattaatattagatgaaatgtcaatggttgatgttacaacaatgtat
gcagcaataagcgcactgccaagcactgctgctctctttttagttggggatattgatcaa
ctgccatcagtaggaccaggtcaggtttttagtgatttaattaagtctcaaaaattccct
atagtaacattaacagaaatttttaggcaaaataatcaaagtagcattattagcaatgcc
catagaattaataacggattttttccaattttacaatctagccaaaactcaaataatgat
ttttattttattaatagtgatacaccagaggatgctattgataaaataactgaattagtt
caggtacgcctaccaaaaaaattttctatttctccattcacagatatacaaatattatct
ccaataaccagaggaatcgtaggaacaaagaatctcaattcagtattacaaaaagtacta
ttaccaagtaactcagcaaatgatgaattacttatttggggcaatatttttaaaattggt
gataaggttatgcaagtagttaataattatgacaaagatatatataacggtgacatagga
attattaatacaattgatcatgaaaaccaaaatatagtaataaattttgatggtaataaa
ataagctatgactttgatgagattgatgaaatagtacttgcttatgctattactattcat
aagtcacaaggtggagaatatcacactgtaattattccattaatgatgcaacattatcct
atgctacaacgaaagttaatttatactgctattaccagagcaaaaaagttagttattgtc
gttggtcaaaaaaaagcattaaatattgctattaaaaaaaatatagcagaactaaggtat
tctatgctcaagaaaaaattaatggatataacttag

DBGET integrated database retrieval system