KEGG   Orientia tsutsugamushi Boryong: OTBS_0555Help
Entry
OTBS_0555         CDS       T00531                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ots01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ots00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(525557..526723)
Genome map
AA seq 388 aa AA seqDB search
MISKKLIIELLKQLISFKSVTPNDNGAIDFITNLLVKQGFKVYVKEFGQEYKVKNLYGYF
GNGQPNICFAGHIDVVPAGFIEQWKYPPFCATQYKDKIYGRGVVDMKGAISAMLSSVFCF
IDNNHDFNGTISFLITADEEGEALFGTKKMLEWIYRQGHKIDFTILGEPTCTDKIGDTIK
IGRRGSINFDLKVFGKQGHVAYPHLAINPNHLIVKILNRLIAYKIDEGNEFFAPSNLEIV
SIDTNNNITNIIPEIAKSKFNIRFNDIHTNERLLEIVKKTIEQFTTNYDLQSSCRSRPFL
AKMSPYIFSFKELVHKVTKIKPEFSTSGGTSDAYFFKDYSPIVEFGLLNTMAHKINEYCL
INDLQTLCRVYYNALCLFLMSNSKFRTN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgataagtaaaaaattaattattgagctattaaaacagttaataagctttaagtctgtt
acaccaaatgataatggtgcaatagactttattactaatttacttgtaaaacaagggttt
aaggtttatgtaaaggagtttggtcaggaatataaagttaaaaatctttatggatatttt
ggtaatgggcagccaaatatatgttttgctggtcacattgatgtagtacctgccggattt
attgaacaatggaaatatcctcctttttgcgctactcagtataaagataaaatttatggt
agaggtgttgtagatatgaaaggggcaatatctgcaatgttatcttcagtattctgtttt
attgataacaatcatgattttaatggaacaattagttttttaattacagctgatgaggaa
ggtgaagcattatttggtaccaaaaaaatgttggagtggatttacaggcaagggcataaa
atagattttactattttaggcgaaccgacatgtacagacaaaattggtgatactataaag
attggcagacgtggtagtataaattttgatttaaaagtctttggcaagcaaggtcatgta
gcttatccacatttggctattaatccaaatcatttaattgtgaagattttgaataggttg
attgcttataagatagatgaaggcaatgaattttttgcaccatctaatttagaaattgtt
tcaatagatacaaacaataatattacaaatattatacctgaaatagctaaatcaaagttt
aatatcaggtttaatgatattcatactaatgagcggttgttagagattgttaaaaaaact
attgaacaatttactacaaactatgacttacaatcaagttgcaggtcaagaccattttta
gcaaaaatgtctccttatattttcagttttaaagaattagtacataaagtaacaaaaata
aagccagaattttcaacttcaggaggcacatctgatgcttatttttttaaagattattct
cctattgtagaatttggattattaaatactatggctcacaaaattaatgagtattgttta
attaatgatttacaaactttatgtagagtgtattataatgctttatgcttgtttctaatg
agcaatagcaaatttagaacaaattaa

DBGET integrated database retrieval system