KEGG   Orientia tsutsugamushi Boryong: OTBS_0788Help
Entry
OTBS_0788         CDS       T00531                                 

Gene name
gmpk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
ots00230  Purine metabolism
ots01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OTBS_0788 (gmpk)
Enzymes [BR:ots01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OTBS_0788 (gmpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 IstB_IS21 Fib_alpha RNA_helicase AAA MMR_HSR1 ABC_tran
Motif
Other DBs
NCBI-ProteinID: CAM79854
UniProt: A5CDD9
Position
766361..767026
Genome map
AA seq 221 aa AA seqDB search
MFISFPKPAIALIISSPSGAGKSSLAHAVIQNNINIKFSVSMTTREKRNNEINGKDYIFV
TKEQFEQEINNNTLLEFSKVFNNYYGIPKAGVLEDLSQGQSIIFDIDWQGAKTIRKALKC
YVVSVCILPPSMQELENRLKKRNKDSPETIRYRLEQAKEDIKHYSEYDYVIVNDRFDQAL
LALQSILIAEQHKLKRLSFKNDTLLNYEQLLQRDACFNYRQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttattagttttccaaaacctgctatagcacttataatatcatctccatctggggct
gggaaatcaagcttagctcatgcggttattcaaaataatatcaatattaaattctctgtt
tcaatgacaactagagaaaaacgtaataatgaaataaatggcaaagactatatctttgtg
acaaaagaacaattcgaacaggaaattaacaacaatacacttcttgaattttctaaagta
ttcaacaactactatggcattccaaaagctggggtgttagaagatcttagtcaaggtcag
agcattatttttgatatcgattggcaaggcgctaaaacaatacgaaaggctctgaaatgt
tatgtcgttagtgtatgcatacttcctccatcaatgcaagagctagaaaatagattaaaa
aaacgtaataaagattctccagaaactattcgctaccgtttagaacaagcaaaagaagat
attaagcattatagcgaatatgattatgtaatagtaaatgaccgctttgatcaagcatta
cttgctttgcaatcaatactgatagctgaacagcataagttaaaaagactgagttttaaa
aatgatacactgttaaattatgaacaattgttacaaagagatgcatgctttaattataga
caatga

DBGET integrated database retrieval system