KEGG   Orientia tsutsugamushi Boryong: OTBS_0788Help
Entry
OTBS_0788         CDS       T00531                                 

Gene name
gmpk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OTBS_0788 (gmpk)
Enzymes [BR:ots01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OTBS_0788 (gmpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
766361..767026
Genome map
AA seq 221 aa AA seqDB search
MFISFPKPAIALIISSPSGAGKSSLAHAVIQNNINIKFSVSMTTREKRNNEINGKDYIFV
TKEQFEQEINNNTLLEFSKVFNNYYGIPKAGVLEDLSQGQSIIFDIDWQGAKTIRKALKC
YVVSVCILPPSMQELENRLKKRNKDSPETIRYRLEQAKEDIKHYSEYDYVIVNDRFDQAL
LALQSILIAEQHKLKRLSFKNDTLLNYEQLLQRDACFNYRQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttattagttttccaaaacctgctatagcacttataatatcatctccatctggggct
gggaaatcaagcttagctcatgcggttattcaaaataatatcaatattaaattctctgtt
tcaatgacaactagagaaaaacgtaataatgaaataaatggcaaagactatatctttgtg
acaaaagaacaattcgaacaggaaattaacaacaatacacttcttgaattttctaaagta
ttcaacaactactatggcattccaaaagctggggtgttagaagatcttagtcaaggtcag
agcattatttttgatatcgattggcaaggcgctaaaacaatacgaaaggctctgaaatgt
tatgtcgttagtgtatgcatacttcctccatcaatgcaagagctagaaaatagattaaaa
aaacgtaataaagattctccagaaactattcgctaccgtttagaacaagcaaaagaagat
attaagcattatagcgaatatgattatgtaatagtaaatgaccgctttgatcaagcatta
cttgctttgcaatcaatactgatagctgaacagcataagttaaaaagactgagttttaaa
aatgatacactgttaaattatgaacaattgttacaaagagatgcatgctttaattataga
caatga

DBGET integrated database retrieval system