KEGG   Orientia tsutsugamushi Boryong: OTBS_1491Help
Entry
OTBS_1491         CDS       T00531                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OTBS_1491 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OTBS_1491 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    OTBS_1491 (sucB)
Enzymes [BR:ots01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OTBS_1491 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452865..1454142
Genome map
AA seq 425 aa AA seqDB search
MTEKNKETNIVLPSLGESVSTGTISKWHKKEGDIVALDEKIVEVESDKVGIDINANVPGK
ITKILKNEGDNVEVGEVICVIRSDVLQKEIHSSKSSEIDINLSICEDIISANKLSPAVAK
MVAEHKINPENISGSGKNNRITKGDIIDVIDSNLNNNNITSTKDIQTQQLQISTLIRETS
TQTASVLTDVKASRTIERVKMTRLRRTIAQRLKDSQNNAAILSTFNEVDMFNVSELRKKY
KEEFEKKHEIKLGFMSFFVKAATAALQELPIINAQVDGYDILYHNYCDIGVAVSTNSGLV
VPIIRNAEHLSFAEIEMEISQLGKKAREGNLSINELSGGTFSITNGGVFGSLLSTPIINP
PQSAIMGMHKIQDRPVVINGTIQIRPMMYIVLSYDHRIIDGKEAVTFLTKVKSYIESPER
LLLNI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaaataaggaaacaaatatagtgttgccatcacttggagaatcagtatca
actgggacaatatctaaatggcataaaaaagaaggggatatagtcgcgctagatgagaaa
atagtagaggtagaaagtgacaaagtaggaatagatattaacgctaatgtacctggaaaa
ataactaaaattttaaaaaacgaaggcgataatgttgaggttggagaagtaatttgtgtt
attagatcagatgttttacagaaagaaattcatagcagtaaaagtagtgagattgatata
aatctatcaatctgcgaagatattatttctgctaataaattgtctcctgctgttgctaaa
atggtagcagagcataaaattaatcctgagaatattagcggtagtggaaaaaataataga
attacaaaaggtgatattattgatgttatagattcaaacttaaataataacaatataaca
tcaacaaaagatatacaaactcagcaattacagatatcaacattaatacgtgagacatca
acgcaaacagcatcagtgttaactgatgtaaaagctagtagaacaatagaacgagtgaaa
atgactagattgagacgtactattgctcaacgcttaaaagattctcaaaacaatgctgct
attctatctacctttaatgaagttgatatgtttaatgtatcggaattaaggaaaaaatat
aaagaagaatttgaaaaaaaacatgaaattaaacttggttttatgtcattttttgttaaa
gcagcaactgcagctttgcaagagcttccaataattaatgctcaagttgatggttatgac
atactatatcacaattactgcgatataggagtagcagtaagtactaattccggattagtt
gtgccaataataaggaatgctgaacatctttcttttgctgagatagaaatggaaatttct
cagttaggtaaaaaagctagagaaggaaatttatcgattaatgaacttagtggaggaact
ttctctattactaatggaggagtgtttggttcattgctgtcaaccccaattattaatccg
cctcaatctgcaataatgggaatgcataaaatacaggacaggcctgtagtaattaatggc
actatacaaattaggccaatgatgtatatagtattatcatatgatcacagaattattgat
ggtaaggaggcagtgacatttttaactaaagtaaaaagctatatagaatcaccagaaagg
ctattgcttaatatttaa

DBGET integrated database retrieval system