KEGG   Orientia tsutsugamushi Boryong: OTBS_1697Help
Entry
OTBS_1697         CDS       T00531                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
ots00020  Citrate cycle (TCA cycle)
ots00190  Oxidative phosphorylation
ots00650  Butanoate metabolism
ots01100  Metabolic pathways
ots01110  Biosynthesis of secondary metabolites
ots01120  Microbial metabolism in diverse environments
ots01130  Biosynthesis of antibiotics
ots01200  Carbon metabolism
Module
ots_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ots_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OTBS_1697 (sdhD)
   00650 Butanoate metabolism
    OTBS_1697 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    OTBS_1697 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS TspO_MBR
Motif
Other DBs
NCBI-ProteinID: CAM80792
UniProt: A5CEW4
Position
1650707..1651096
Genome map
AA seq 129 aa AA seqDB search
MKAQNLQNSLNTIKSLSTDKYCVQHWRYQRLSAILMLPLLVWLVFFGKAIVQKSPVELVE
LVKYPYNVLMIILLLITMFFHAAIGLKVIIEDYVNNLAVRYLLIVLVQCFTFVTVVAGII
SIILLCINY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaaaatttacaaaacagtttaaatacaattaagagtctaagtactgataag
tattgtgtgcaacattggcggtatcagagacttagtgctatattaatgttgccattatta
gtatggctagtattctttggtaaggcaatagttcaaaaatctccagtagagctagtagag
ctagtaaagtatccttacaatgtattaatgattattttattattgattacaatgtttttc
catgctgcaataggactaaaagtcataatagaagattatgtcaataatcttgcagtaaga
tatttattgattgttttagtacaatgttttacctttgtaactgtagttgcaggaatcata
tctataatattattatgtattaattattaa

DBGET integrated database retrieval system