KEGG   Orientia tsutsugamushi Boryong: OTBS_1697Help
Entry
OTBS_1697         CDS       T00531                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:ots01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ots00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ots00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650707..1651096
Genome map
AA seq 129 aa AA seqDB search
MKAQNLQNSLNTIKSLSTDKYCVQHWRYQRLSAILMLPLLVWLVFFGKAIVQKSPVELVE
LVKYPYNVLMIILLLITMFFHAAIGLKVIIEDYVNNLAVRYLLIVLVQCFTFVTVVAGII
SIILLCINY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaaaatttacaaaacagtttaaatacaattaagagtctaagtactgataag
tattgtgtgcaacattggcggtatcagagacttagtgctatattaatgttgccattatta
gtatggctagtattctttggtaaggcaatagttcaaaaatctccagtagagctagtagag
ctagtaaagtatccttacaatgtattaatgattattttattattgattacaatgtttttc
catgctgcaataggactaaaagtcataatagaagattatgtcaataatcttgcagtaaga
tatttattgattgttttagtacaatgttttacctttgtaactgtagttgcaggaatcata
tctataatattattatgtattaattattaa

DBGET integrated database retrieval system