KEGG   Orientia tsutsugamushi Boryong: OTBS_1817Help
Entry
OTBS_1817         CDS       T00531                                 

Gene name
cycC
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ots00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OTBS_1817 (cycC)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OTBS_1817 (cycC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1752135..1752683)
Genome map
AA seq 182 aa AA seqDB search
MDGFELNKVAASILLTGVIIMSVTILTDTLYKPLLLPAKRGYHVDDISDQAQQGNFSPLA
KDAIFELDEQKIAELIKNASLESGSKLFKQKCSSCHTSNKDGVNRVGPNLYDVVNRIKAT
YPNYNYSAAMTSQGGSWDEKSLFLYLHKPTKYIPGTRMSFIGLPNAKDIADVIKFLKENT
NK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggacggctttgaactaaacaaagtagctgcatctattttattaacaggtgtaataata
atgtcagtaactatattaactgatactttatataagccacttctacttcctgctaagcgt
ggttatcatgttgatgatattagcgatcaagctcaacagggtaactttagtccattagca
aaagatgctatattcgagcttgatgaacaaaaaattgctgaattaataaaaaatgctagc
ttagaatctggtagtaagcttttcaaacaaaaatgctcttcttgtcatactagtaataag
gatggagttaacagagttggacctaatttatatgatgtcgtaaatagaattaaagctact
tatccaaattataattactctgctgcaatgacttctcaaggtggtagctgggatgagaaa
tctttgtttttatatttacataaaccaactaaatacattccaggtactagaatgtcgttt
attggattacctaatgctaaagatatagcagatgtaataaaatttttaaaagaaaatact
aataaataa

DBGET integrated database retrieval system