KEGG   Orientia tsutsugamushi Ikeda: OTT_0081Help
Entry
OTT_0081          CDS       T00705                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ott00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OTT_0081 (recD)
Enzymes [BR:ott01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OTT_0081 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84276..86471
Genome map
AA seq 731 aa AA seqDB search
MSVFSYSTKASSINNQSLAGLVERVTFHNTDNGFCIIKVKVNHKKDLITVIGNSATISAG
QHIEASGIWFNDKEYGLQFKAHTLKVSVPTSIEGIEKYLASGLIKGIGPIYAKKLVQTFG
LDVLTVIENQDPALKKVPGIGPIRAKKIWESWNSQKIISDIMLFIHNYNIGASKAVKIYK
AYGAEAINIIKSNPYQLVSDIKGIGFKSADNIAKAIGIPENSMIRARAGLNYALVTAMSN
GSCGMPTDKLINLCHELLNIDVSIIIDALSFEINERNVAVENINGEECIFLKGLAYAELK
IAELLVHISKGKLAWNPISSNKITEYISKANIKLSPSQQDALHQALKSKVMIITGGPGVG
KTTLINSIINILKSEGVVILLAAPTGRAAKRLSEATQHPAHTIHRLVYSRPGQDVRTITK
LKCQLLILDEMSMVDVTTMYAAISALPSTASLFLVGDIDQLPSVGPGQVFSDLIKSQKFP
IVTLTEIFRQNNQSSIISNAHRINNGFFPILQSSQNSNNDFYFINSDTPEDAIDKITELV
QVRLPKKFSISPFTDIQILSPITRGIVGTKNLNSVLQKVLLPSTSANDELLIWGNVFKIG
DKVMQIVNNYDKDIYNGDIGIINTIDHENQNIVINFDGNKISYDFDELDEIVLAYAITIH
KSQGGEYHTVIIPLMMQHYPMLQRKLIYTAITRAKKLVIVVGQKKALNIAIKKNIAELRY
SMLKKKLMDIT
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattttcttactctacaaaagcctcgtctatcaataatcaaagtttagcagga
ttagtagaaagagtaacttttcataatactgacaatggattttgcatcattaaagttaaa
gtcaatcataagaaagacttaataacagtaattggtaacagtgccaccatttcagctgga
cagcatattgaagctagcggcatatggtttaatgataaagaatatggactgcagtttaaa
gctcatacattaaaagtttcagtaccaacaagtatagagggtatagaaaaatatttagca
tctggattgattaaaggcattggtccgatatatgctaaaaaattagtccaaacatttggc
ttggatgttcttacagtaattgaaaatcaggatccagcattaaaaaaggtgccaggaata
ggtccaattcgtgcaaaaaaaatttgggaaagttggaatagccagaaaattataagtgat
ataatgctgtttattcataactataatattggcgctagtaaagctgttaaaatatataag
gcttatggagcagaagcaataaatattattaaatctaatccctatcaattagtatcggat
attaaaggcatagggtttaaaagtgcagataacattgcaaaagctattggcattccagaa
aattcaatgataagagcacgagctgggctaaattatgctctagttacagctatgagtaat
ggtagttgtggcatgccaactgataagctaattaatctatgtcatgagttgttaaatatt
gatgttagcattataattgatgcactatcctttgaaatcaatgaacgaaatgttgctgtt
gaaaacataaatggtgaagaatgtatatttcttaagggattagcttatgcagagcttaaa
atagccgaattattagtccatattagtaaaggtaaactagcatggaatccaatcagcagc
aataaaataacagaatacataagtaaggcaaatatcaaactatcacctagtcagcaagat
gctcttcatcaagctttgaagtctaaagtaatgattattactggaggtcctggagttggc
aaaactactttaatcaattccataattaatattctaaaaagtgaaggagttgtaatattg
cttgctgctccaactggcagagcagcaaagaggttaagcgaagctactcaacatcccgct
catactattcatcgtttagtatatagtcgtccaggacaagatgtacgaacaatcacaaaa
ctcaaatgtcagttattaatattagatgaaatgtcaatggttgatgttacaacaatgtat
gcagcaataagcgcactgccaagcactgcttctctctttttagtcggagatattgatcaa
ctgccatcagtaggaccaggtcaggtttttagtgatttaattaagtctcaaaaatttcct
atagtaacattaacagaaatttttaggcaaaataatcaaagtagcattattagcaatgcc
catagaattaataacggattttttccaattttacaatctagccaaaactcaaataatgat
ttttattttattaatagcgatacaccagaggatgcgattgataaaataactgaattagtt
caggtacgcttaccaaaaaaattttctatttctccatttacagatatacaaatattatct
ccaataaccagaggaattgtaggaacaaagaatctcaattcagtattacaaaaagtacta
ttaccaagtacctcagcaaatgatgaattacttatttggggcaatgtgtttaaaattggt
gataaggttatgcaaatagttaataattatgataaagatatatataacggtgacatagga
attattaatacaattgatcatgaaaaccaaaatatagtaataaactttgatggtaataaa
ataagctatgattttgatgagcttgatgaaatagtacttgcttatgctattactattcat
aagtcacaaggtggagaataccacactgtaattattccattaatgatgcaacattatcct
atgctacaacgaaagttaatttatactgctattaccagagcaaaaaagttagttattgtt
gttggtcaaaaaaaagcattaaatatcgctattaaaaaaaacatagcagaactaaggtat
tctatgctcaagaaaaaattaatggatataacttaa

DBGET integrated database retrieval system