KEGG   Orientia tsutsugamushi Ikeda: OTT_0629Help
Entry
OTT_0629          CDS       T00705                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ott00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OTT_0629 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OTT_0629 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    OTT_0629 (sucB)
Enzymes [BR:ott01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OTT_0629 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656500..657777
Genome map
AA seq 425 aa AA seqDB search
MKETNQDTNIVLPSLGESVSTGTISKWHKKEGDIVALDEKIVEVESDKVGIDINANVPGK
ITKILKNEGDNVEVGEVICIIRSDVSQKEIHSSKSSDTDITLSSCENIISANKLSPAVAK
MVAEHKINPENISGSGKNNRITKGDIINVIDSNLNNNNITSINDIQTQQLQIPTLIRDTS
TQTASVLTAVKASRTIERVKMTRLRRTIAQRLKDSQNNAAILSTFNEVDMFNVSELRKKY
KEEFEKKHEIKLGFMSFFVKAAITALQELPIINAQVDGNDILYHNYCDIGVAVSTSSGLV
VPIIRNAEHLSFAEIEMEISQLGKKAREGNLSINELSGGTFSITNGGVFGSLLSTPIINP
PQSAIMGMHKIQDRPVVINGTIQIRPMMYIVLSYDHRIIDGKEAVTFLTKVKSYIESPER
LLLNI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacaaatcaggacacaaatatagtattaccatcacttggagagtcagtgtca
acaggaacaatatctaaatggcataaaaaagaaggtgatatagttgcgctagatgagaaa
atagtagaggtggaaagtgacaaagtaggaatagatattaacgctaatgtacctggaaaa
ataactaaaattctaaaaaacgaaggagataatgttgaagttggagaagtaatttgcatt
attagatcagatgtttcacagaaagaaattcatagcagtaaaagtagtgatactgatata
actctatcaagttgtgaaaatattatttctgctaataagttgtctcctgcggttgctaaa
atggtagcagagcataaaatcaatcctgagaatattagtggtagtggaaaaaataataga
attacaaaaggtgatattattaatgttatagattcaaacttaaataataacaatataaca
tcaataaatgatatacaaactcagcaattacagataccaacattaatacgtgatacatca
acgcaaacagcatcagtgttaactgctgtaaaagctagtagaacaatagaacgagtaaaa
atgactagattgagacgtactattgctcaacgcttaaaagattctcaaaacaatgctgcc
attctatctacctttaatgaagttgatatgtttaatgtatcagaattaaggaaaaaatat
aaagaagaatttgaaaaaaagcatgaaattaaacttggttttatgtcattttttgttaaa
gcggcaattacagctttacaagagcttccaataattaatgctcaagttgatggtaatgac
atactatatcacaattactgcgatataggagtagcagtaagtactagttctggattagtt
gtgccaataataagaaatgctgaacatctttcttttgctgagatagaaatggaaatttct
cagttaggtaaaaaagctagagaaggaaatttatcgattaatgaacttagtggtggaact
ttctctattactaatggaggagtgtttggctcattgctgtcaactccaattattaatccg
cctcaatctgcaataatgggaatgcataaaatacaggacaggcctgtagtaattaatggc
actatacaaattaggccaatgatgtatatagtattatcatatgatcacagaattattgat
ggtaaggaagcagtgacatttttaactaaagtaaaaagctatatagaatcaccagaaagg
ctattgcttaatatttaa

DBGET integrated database retrieval system