KEGG   Orientia tsutsugamushi Ikeda: OTT_0629Help
Entry
OTT_0629          CDS       T00705                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
ott00020  Citrate cycle (TCA cycle)
ott00310  Lysine degradation
ott01100  Metabolic pathways
ott01110  Biosynthesis of secondary metabolites
ott01120  Microbial metabolism in diverse environments
ott01130  Biosynthesis of antibiotics
ott01200  Carbon metabolism
Module
ott_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ott_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ott00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OTT_0629 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    OTT_0629 (sucB)
Enzymes [BR:ott01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OTT_0629 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF4602
Motif
Other DBs
NCBI-ProteinID: BAG40087
UniProt: B3CRA3
Position
656500..657777
Genome map
AA seq 425 aa AA seqDB search
MKETNQDTNIVLPSLGESVSTGTISKWHKKEGDIVALDEKIVEVESDKVGIDINANVPGK
ITKILKNEGDNVEVGEVICIIRSDVSQKEIHSSKSSDTDITLSSCENIISANKLSPAVAK
MVAEHKINPENISGSGKNNRITKGDIINVIDSNLNNNNITSINDIQTQQLQIPTLIRDTS
TQTASVLTAVKASRTIERVKMTRLRRTIAQRLKDSQNNAAILSTFNEVDMFNVSELRKKY
KEEFEKKHEIKLGFMSFFVKAAITALQELPIINAQVDGNDILYHNYCDIGVAVSTSSGLV
VPIIRNAEHLSFAEIEMEISQLGKKAREGNLSINELSGGTFSITNGGVFGSLLSTPIINP
PQSAIMGMHKIQDRPVVINGTIQIRPMMYIVLSYDHRIIDGKEAVTFLTKVKSYIESPER
LLLNI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacaaatcaggacacaaatatagtattaccatcacttggagagtcagtgtca
acaggaacaatatctaaatggcataaaaaagaaggtgatatagttgcgctagatgagaaa
atagtagaggtggaaagtgacaaagtaggaatagatattaacgctaatgtacctggaaaa
ataactaaaattctaaaaaacgaaggagataatgttgaagttggagaagtaatttgcatt
attagatcagatgtttcacagaaagaaattcatagcagtaaaagtagtgatactgatata
actctatcaagttgtgaaaatattatttctgctaataagttgtctcctgcggttgctaaa
atggtagcagagcataaaatcaatcctgagaatattagtggtagtggaaaaaataataga
attacaaaaggtgatattattaatgttatagattcaaacttaaataataacaatataaca
tcaataaatgatatacaaactcagcaattacagataccaacattaatacgtgatacatca
acgcaaacagcatcagtgttaactgctgtaaaagctagtagaacaatagaacgagtaaaa
atgactagattgagacgtactattgctcaacgcttaaaagattctcaaaacaatgctgcc
attctatctacctttaatgaagttgatatgtttaatgtatcagaattaaggaaaaaatat
aaagaagaatttgaaaaaaagcatgaaattaaacttggttttatgtcattttttgttaaa
gcggcaattacagctttacaagagcttccaataattaatgctcaagttgatggtaatgac
atactatatcacaattactgcgatataggagtagcagtaagtactagttctggattagtt
gtgccaataataagaaatgctgaacatctttcttttgctgagatagaaatggaaatttct
cagttaggtaaaaaagctagagaaggaaatttatcgattaatgaacttagtggtggaact
ttctctattactaatggaggagtgtttggctcattgctgtcaactccaattattaatccg
cctcaatctgcaataatgggaatgcataaaatacaggacaggcctgtagtaattaatggc
actatacaaattaggccaatgatgtatatagtattatcatatgatcacagaattattgat
ggtaaggaagcagtgacatttttaactaaagtaaaaagctatatagaatcaccagaaagg
ctattgcttaatatttaa

DBGET integrated database retrieval system