KEGG   Orientia tsutsugamushi Ikeda: OTT_1184Help
Entry
OTT_1184          CDS       T00705                                 

Gene name
rpsL
Definition
30S ribosomal protein S12
Orthology
K02950  
small subunit ribosomal protein S12
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ott00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OTT_1184 (rpsL)
Ribosome [BR:ott03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    OTT_1184 (rpsL)
  Bacteria
    OTT_1184 (rpsL)
  Archaea
    OTT_1184 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207941..1208312
Genome map
AA seq 123 aa AA seqDB search
MPTNNQLVRCGRKSKIRASKSPALNGNPFAKGVCVLVKTITPRKPNSALRKMARVRFRNG
TCVNAYIPGEGHNLQEHSTVLVRGGRVPDLPGVRYHIVRGVYDTQGVKNRKQGRSRYGAK
RPK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaaataatcaactagtgcgttgtggccgtaaatctaaaattagagcttctaaa
tcaccagctctaaatgggaatccttttgctaaaggagtatgcgttttagttaaaactatt
acacctagaaagcctaattccgctttacgaaaaatggcacgtgtacgtttcagaaatggg
acttgtgttaatgcttatattcctggagagggacataatctacaggaacactctacagtg
ttagtaaggggaggaagagttccagatttgcctggtgtgcgttatcatattgtacgtggt
gtttatgatactcagggagttaaaaatcgtaaacaaggtcgttcaaggtatggtgctaag
cgtccaaagtaa

DBGET integrated database retrieval system