KEGG   Orientia tsutsugamushi Ikeda: OTT_1312Help
Entry
OTT_1312          CDS       T00705                                 

Gene name
cycM
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
ott02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ott00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OTT_1312 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 zf-3CxxC GAS2 Dehyd-heme_bind
Motif
Other DBs
NCBI-ProteinID: BAG40770
UniProt: B3CTS3
Position
complement(1329545..1330093)
Genome map
AA seq 182 aa AA seqDB search
MDGFELNKVAASVLLTGVIIMSVTILTDTLYKPLLLPAKRGYHVDAISDQAQQSNFSPLA
KEAIFELDEQKIAELIKNASLESGSKLFKQKCSSCHTSNKDGVNRVGPNLYNVVNRIKAT
YPNYNYSAAMASQGGSWDEKSLFLYLHKPTKYIPGTRMSFIGLPNAKDIADVIKFLKENT
NK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggacggctttgaactaaacaaagtagctgcatctgttttattaacaggggtaataata
atgtcagtaactatattaactgatactttatataagccacttctacttcctgctaagcgt
ggttatcatgttgatgccattagcgatcaagctcaacagagtaactttagtccattagca
aaagaggctatattcgagcttgatgaacaaaaaattgctgaattaataaaaaatgctagc
ttagaatctggtagtaagcttttcaagcaaaaatgctcttcttgtcatactagtaataag
gatggagttaacagagttggacctaatttatataatgtcgtaaatagaattaaagctact
tatccaaattataattactctgctgcaatggcttctcaaggtggtagctgggatgagaaa
tctttgtttttatatttacataaaccaactaaatacattccaggtactagaatgtcattt
attggattacctaatgctaaagatatagcagatgtaataaaatttttaaaagaaaatact
aataaataa

DBGET integrated database retrieval system