KEGG   Orientia tsutsugamushi Ikeda: OTT_1312Help
Entry
OTT_1312          CDS       T00705                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ott00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ott02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1329545..1330093)
Genome map
AA seq 182 aa AA seqDB search
MDGFELNKVAASVLLTGVIIMSVTILTDTLYKPLLLPAKRGYHVDAISDQAQQSNFSPLA
KEAIFELDEQKIAELIKNASLESGSKLFKQKCSSCHTSNKDGVNRVGPNLYNVVNRIKAT
YPNYNYSAAMASQGGSWDEKSLFLYLHKPTKYIPGTRMSFIGLPNAKDIADVIKFLKENT
NK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggacggctttgaactaaacaaagtagctgcatctgttttattaacaggggtaataata
atgtcagtaactatattaactgatactttatataagccacttctacttcctgctaagcgt
ggttatcatgttgatgccattagcgatcaagctcaacagagtaactttagtccattagca
aaagaggctatattcgagcttgatgaacaaaaaattgctgaattaataaaaaatgctagc
ttagaatctggtagtaagcttttcaagcaaaaatgctcttcttgtcatactagtaataag
gatggagttaacagagttggacctaatttatataatgtcgtaaatagaattaaagctact
tatccaaattataattactctgctgcaatggcttctcaaggtggtagctgggatgagaaa
tctttgtttttatatttacataaaccaactaaatacattccaggtactagaatgtcattt
attggattacctaatgctaaagatatagcagatgtaataaaatttttaaaagaaaatact
aataaataa

DBGET integrated database retrieval system