KEGG   Orientia tsutsugamushi Ikeda: OTT_1338Help
Entry
OTT_1338          CDS       T00705                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ott00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OTT_1338 (tpiA)
   01230 Biosynthesis of amino acids
    OTT_1338 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OTT_1338 (tpiA)
   00051 Fructose and mannose metabolism
    OTT_1338 (tpiA)
   00562 Inositol phosphate metabolism
    OTT_1338 (tpiA)
Enzymes [BR:ott01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OTT_1338 (tpiA)
Exosome [BR:ott04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OTT_1338 (tpiA)
  Exosomal proteins of bladder cancer cells
   OTT_1338 (tpiA)
  Exosomal proteins of melanoma cells
   OTT_1338 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1362877..1363626
Genome map
AA seq 249 aa AA seqDB search
MESIVVSNWKMHFSFSEACNYLNLITSLNSNLNLAKMIFAVPNLYLSGLKLKFNDTYHFS
AQDVSMITESSGPYTGEISASMLKNLNVNYAIVGHSERRLLFYEDANTIALKVRNCINNA
IVPIVCIGEPIEARKNKTYLQYLAQQLSSISFSFTKNVIIAYEPIWSIGSDMIPTIDDIY
EVVTMIREIQNRYIPHNIENSVKIVYGGSVSANNIHQILTAGVDGVLIGKASLKLESLTT
IIKTVQGLD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaattgtagtttctaattggaaaatgcactttagtttttctgaagcttgcaat
tacctaaatttaataactagcttaaatagcaatttaaatcttgctaagatgatatttgct
gtaccaaatttatatttatctgggcttaaattaaaatttaatgacacatatcatttttca
gctcaagatgtaagcatgattacagaaagtagtggcccatatactggtgagataagtgct
agtatgttgaaaaacttaaatgtgaactatgctatagtagggcactcagaacgaaggcta
ttattttatgaggatgctaatacaatagcattaaaagtaagaaattgtatcaataatgca
atagtcccaattgtatgtataggagaaccaattgaagcacgaaaaaataaaacatatctt
caatatctagctcaacagttaagtagtatatcttttagttttactaagaatgttatcatt
gcttatgagccaatatggtcaattggcagtgatatgattcctaccattgatgatatttat
gaggtagtaactatgattagagaaatacaaaataggtatatacctcataatattgaaaat
agtgttaaaatagtatatggtggttctgtttcagctaataatattcaccaaattctaaca
gctggcgttgatggagtattaattggtaaggcatctttaaaattagaaagtttaactaca
ataataaaaacagttcaaggtttagattaa

DBGET integrated database retrieval system