KEGG   Orientia tsutsugamushi Ikeda: OTT_1803Help
Entry
OTT_1803          CDS       T00705                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ott00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OTT_1803 (recR)
DNA repair and recombination proteins [BR:ott03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OTT_1803 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1833658..1834269)
Genome map
AA seq 203 aa AA seqDB search
MHKDSNIIDELIFSFAQLPGLGNRSARRIVLYLMQDKEVRIKNLNNQLTSVLNNIMECDY
CGNLDIVSICNICKHSERDSSTIAVVESVADLWALERSKVFKGWYHVLGKTLSAVSGNDA
VNSLKLPKLLNRIREYKVQEIILATNSTIDGQMTAFFVIDYLKDENLKISKLASGIPLGG
ELDYLDEGTLLAAFKARQSHDLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagattctaatataatagacgaattaatattttcttttgctcagttgcctgga
ttaggtaaccgctctgctaggaggatagtgctttatttaatgcaagataaggaagttagg
attaaaaatcttaataatcaattaacttctgtgttaaataatattatggaatgtgattat
tgtggaaatttagatatagtttctatttgtaatatttgcaaacattctgagcgtgattca
tcaaccatagcggtagttgagtctgtagcagatctttgggctttggaacgtagtaaggtt
tttaaaggttggtatcatgttttagggaaaacattatctgctgttagcggtaacgatgct
gttaatagcctaaaattacctaagttattgaatcgtattcgtgagtataaagtacaagaa
ataattttagctactaactcaacaatagatgggcaaatgactgctttttttgttattgat
tatttgaaagatgaaaatttaaaaatctcaaaattggcttccggaattccgttaggtggt
gagttagattatttagatgaaggtactttgttggcagcatttaaagctaggcaatctcat
gatttattatga

DBGET integrated database retrieval system