KEGG   Oscillibacter valericigenes: OBV_02180Help
Entry
OBV_02180         CDS       T01636                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ova  Oscillibacter valericigenes
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OBV_02180
Enzymes [BR:ova01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OBV_02180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207200..208156
Genome map
AA seq 318 aa AA seqDB search
MNLPAKVIVAYTHNVSEPAIRVHKLPKPGETVRAIGCNTGLDGGKGTNVAISMARLGIPT
ALVAHVKSGPWYTKAKQLLAEEHIDDTFVVCDADEKKSGGCVLIDDEGQNMIVLGSQNHQ
VIQPEEIDRALTAMKDARYCVTGYELNTDSVHHILEKAREFEIKTVLNPSPVPAWKPTDW
DLVSLLVVNETEARYMLTLAGASFDPNSWKECMYKIREAYHCGDVVLTLGGDGFCCLEGD
TVTRKHGIRVSATDTTGAGDGFLGAMVARLTVGDTLGDACSWANQFSSITVQRAGTISSY
PTAEEVTALFPELAPMQQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacctgcaaaagtaattgttgcatacactcacaatgtaagtgaacctgcaatt
cgcgtacataagctacccaaacccggcgaaacagtccgggcgattggctgcaataccgga
ttagacggaggaaagggaaccaatgtcgcaatttccatggcgcggcttggcattcccacc
gcactggtggctcatgtaaaaagcgggccatggtacacaaaagccaaacagcttctggcg
gaagaacacattgacgacacttttgtcgtatgtgacgcagacgagaaaaagagcggggga
tgtgtcctgatcgatgacgaggggcagaatatgattgtcctgggaagccagaaccatcag
gtaatccagcccgaggagattgaccgcgcactgactgccatgaaggacgcccggtattgc
gtgaccggatatgagctgaataccgacagcgttcaccatatccttgaaaaagcaagagag
tttgaaatcaaaacggtactgaatccatctcccgtgccagcctggaagcccacggactgg
gatcttgtcagcctgctggttgtaaacgaaacagaggcgcgttatatgctgactttggcc
ggggcctcttttgatccgaatagctggaaagagtgtatgtataaaatccgggaggcgtat
cactgcggggatgtggtattgactctgggcggcgacgggttctgctgtctggagggcgac
accgttacccgcaagcacggtatccgagtctcggccaccgataccactggtgccggcgac
ggatttttgggtgcaatggttgccaggctcacggtgggtgacactctgggagacgcctgt
tcatgggcaaaccagttttccagcatcacggttcagcgtgccgggaccatctccagttat
ccgactgccgaggaagttaccgcgcttttcccggaactggcacctatgcagcagtaa

DBGET integrated database retrieval system