KEGG   Oscillibacter valericigenes: OBV_03000Help
Entry
OBV_03000         CDS       T01636                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00010  Glycolysis / Gluconeogenesis
ova00051  Fructose and mannose metabolism
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
ova01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_03000 (tpiA)
   00051 Fructose and mannose metabolism
    OBV_03000 (tpiA)
   00562 Inositol phosphate metabolism
    OBV_03000 (tpiA)
Enzymes [BR:ova01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OBV_03000 (tpiA)
Exosome [BR:ova04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OBV_03000 (tpiA)
  Exosomal proteins of bladder cancer cells
   OBV_03000 (tpiA)
  Exosomal proteins of melanoma cells
   OBV_03000 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MreB_Mbl
Motif
Other DBs
NCBI-ProteinID: BAK97498
UniProt: G4KRM8
Position
291186..291959
Genome map
AA seq 257 aa AA seqDB search
MNRRYRKTVIAGNWKMNMTATETKKFAEDMKKIMPRAKWCDTLICVPACNISVASRAFKD
LRISVGAENVYFEEKGAYTGEVSADMLKDLAVKYVIVGHSERRQYFGETDDGVNRKVHAV
LSAGMSPIICVGESLEQRETGITNEWIALQVKSALNGVPADKLRRCIVAYEPIWAIGTGK
TATAEQAGEVCSNIRAIIRALYGARVARSVTIQYGGSMNPKNAAELLAQPDIDGGLIGGA
ALKPEQFVEIINAANQD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcgttaccgtaaaactgtgatcgccggcaactggaaaatgaacatgaccgcc
accgagaccaagaagttcgccgaggatatgaagaagatcatgcccagggccaagtggtgt
gataccttgatctgcgtccccgcctgcaatatatccgtggcttcccgggcattcaaggat
ctgcggatttccgtgggcgcagaaaatgtctactttgaggaaaaaggtgcctataccggc
gaggtctctgcggacatgctgaaggacctggcggtcaaatatgtcattgtgggacacagc
gagcggcggcagtatttcggtgaaacggacgatggcgtgaacaggaaggtccacgccgtt
ttgagcgccggtatgagccccatcatctgcgtgggcgagagtctggagcagcgggagacc
ggcattaccaacgagtggattgcgctgcaggtgaaaagcgcgctgaacggcgttcccgcc
gataagctgcgccgctgcatcgtggcctatgagcccatttgggccatcggtaccggcaag
accgccacggcggaacaggccggcgaggtgtgcagcaacatccgcgccataatccgcgcc
ctgtatggcgcccgggtcgctcggtccgtcaccattcagtacggcgggtccatgaatccc
aagaacgccgcggagcttttggcccagccggacatcgacggcggactgatcggcggtgcc
gcactcaagccggagcagtttgtcgaaatcatcaacgccgcgaatcaggactaa

DBGET integrated database retrieval system