KEGG   Oscillibacter valericigenes: OBV_04870Help
Entry
OBV_04870         CDS       T01636                                 

Gene name
porA
Definition
(GenBank) pyruvate synthase subunit PorA (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OBV_04870 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_04870 (porA)
   00020 Citrate cycle (TCA cycle)
    OBV_04870 (porA)
   00620 Pyruvate metabolism
    OBV_04870 (porA)
   00640 Propanoate metabolism
    OBV_04870 (porA)
   00650 Butanoate metabolism
    OBV_04870 (porA)
  Energy metabolism
   00680 Methane metabolism
    OBV_04870 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    OBV_04870 (porA)
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     OBV_04870 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
455538..456716
Genome map
AA seq 392 aa AA seqDB search
MGIRERLSGNEAVALAMKQINPDVMGAFPITPSTEIPQYFSAYVDNGQVDTEFIPVESEH
SAMSTCIGAEAAGCRAISATSSCGLCYMTEMLYVAASDRLPITLAVSCRALSGPININND
HSDAMGVRDAGWLMLFAETNQEAYDNYLQAMRIGEAVGLPIMVCQDGFITSHAIENIELV
EDEKVKAFVGEYKPQHYLLNKDEPMAVGAYATPVYYMEAKRQQAQAMMDAKDVIKKVGAE
FGQMTGRTYGMIEKYEMDDAEEAIVIIGSSAGTAKEAVNELRAQGKKVGLVKVRAFRPFP
AEEICEALKNVKSFAVMDKDDSFNGHCGPMYAEVTASLYAAGVSAPRGISYIYGLGGRDV
RVESIQRVFGELGEIAKTGVTGETYRYLDVRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgagaaagactttccggcaacgaggctgttgccttggcaatgaaacagatt
aaccccgacgtcatgggcgcatttcccatcaccccgtccaccgagatcccccagtatttt
tctgcatatgtggataacggacaggtggacacggagtttatccctgtggagtccgaacac
tccgccatgtccacctgtattggcgcggaggccgccggctgccgcgcgatttccgccacc
tcctcctgcggcctttgctacatgactgagatgctgtacgtggcggcttccgaccgtctt
cccatcacgctggcggtttcctgccgcgccctgtccggccccatcaacatcaacaacgac
cactccgacgccatgggcgtccgggacgcgggctggctgatgctgttcgccgagacgaat
caggaggcgtacgacaactacctgcaggccatgcgcatcggcgaggccgtaggtcttccc
atcatggtgtgccaggacggcttcatcacctcccacgccattgaaaatatcgagctggtg
gaagatgagaaggtcaaggcgttcgtgggcgagtacaagccccagcactacctgctgaac
aaggacgaacccatggccgtgggcgcttatgccacccccgtgtactatatggaggccaag
cggcagcaggcccaggccatgatggacgcgaaggacgtcatcaagaaggtgggcgcggag
ttcggccagatgaccggccgcacctatggaatgatcgagaagtacgagatggacgacgcc
gaggaggccatcgtcatcatcgggtcctccgccggtaccgccaaggaggctgtaaacgag
ctgcgggcacagggtaaaaaggtgggtcttgtcaaggtccgcgccttccgtcctttcccc
gccgaggagatttgtgaggctctaaagaacgtgaagtcctttgccgtcatggacaaggac
gacagcttcaacggccactgcggccccatgtacgccgaggtcaccgcatctctgtacgcc
gcaggcgtcagcgcccccaggggcatcagctatatttatggtctgggcggccgggacgtg
cgggtggagagcatccagcgcgtcttcggcgagctgggcgagatcgccaaaaccggcgtc
acgggcgagacctaccgctatctggacgtgcgggaataa

DBGET integrated database retrieval system