KEGG   Oscillibacter valericigenes: OBV_06330Help
Entry
OBV_06330         CDS       T01636                                 

Definition
putative sugar phosphate class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ova  Oscillibacter valericigenes
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OBV_06330
Enzymes [BR:ova01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OBV_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602735..603382
Genome map
AA seq 215 aa AA seqDB search
MLLREERELVAEYGRKMSADRLSTGTSGNLSIYDPEHGLMAISPSGMGYFDIRPEDVVVT
DLGARMVEGDRKPSSEWALHAAFYRRKPEARAVVHTHSVYCTTFAVLGKPIEAVHYAIAD
AHTDRVPCAPYETFGSPELARVAVDTCGTANAVLLANHGLVVCGDSMQSAYALASNMEFV
AELQYRAMCVGKPNILSGAQMEEVLEKFRTYGQPK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgggaggaacgggagctggtggcggagtacggccgaaaaatgagtgccgac
cgcctgagcacaggcaccagcggaaatctcagcatctatgacccggagcacgggctgatg
gccatcagtccctccggcatggggtattttgacatccggcccgaggatgtggtggtcacg
gatctgggcgcgcggatggtggagggtgaccgaaagccctccagcgagtgggcactccac
gccgcgttctatcggcgcaagccggaggctcgggcggtggtccatacacactccgtatac
tgcaccaccttcgccgtgctgggaaagcccatcgaggcggtccactatgccattgccgac
gcgcataccgaccgggtgccctgtgcaccctacgagaccttcggctcgccagagctggca
cgcgtcgccgtggatacctgcggaacggcgaacgcggtgctgctggcaaaccacgggctg
gtggtttgcggagacagtatgcaaagcgcctatgctctggccagcaatatggaattcgtc
gcggagctgcaatatcgggccatgtgcgtgggcaagcccaatatcctcagcggcgcgcag
atggaggaggttctggagaagttcagaacctacggacagccgaaataa

DBGET integrated database retrieval system