KEGG   Oscillibacter valericigenes: OBV_09170Help
Entry
OBV_09170         CDS       T01636                                 

Gene name
res
Definition
putative type III endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ova  Oscillibacter valericigenes
Brite
Enzymes [BR:ova01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     OBV_09170 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862910..865885
Genome map
AA seq 991 aa AA seqDB search
MKLQFDANLQYQEQAVSAVVDLFRGQTPKQSNFTVSAYAGQIGMEDTNHGIGNKLELTED
ELLTNLQAVQLRNGLPQTKALKKNTYDFDVEMETGTGKTYVYLRTIFELNKAYGFSKFVI
VVPSIAIKEGVYKNLQITQEHFGNLYDNTVYDYFIYDSNKLEQVRSFAVSDHISIMVINI
DAFRKSFDDPDKESKANIIHRQNDKLNGMRPIELIQETRPFVIVDEPQSVEGKGAVASKK
AMTSLNALCTLRYSATHVVKHNLVYKLDAVDAFDMELVKQIEVASFESVDYHNNAYMKLL
SVDNKKSPITAKIEMDCEINGSVKRKPVTVRQSDDLSEKKLGNRAIYEGYIVDEIYCEQG
NEYVSFSTKPTILRIGETVGDIDDLAIKEQQIRKTIEEHLNKELALNHRGIKVLSLFFID
RVANYRYYDKDGTAHQGPYAEIFERNYKELIQRPKYRTLFQDVDVDTPVGKVHGGYFSVD
KKGTLKDTNGTTSADDDTYNLIMKDKERLLSFESPLRFIFSHSALREGWDNPNVFQICTL
NETKSDVKKRQEIGRGLRLCVNQNGERQHGFAINTLTVMANESYDVFAKKLQSEYETDEG
IRFGVLESHSFANIPVKQADGSVAYLGMEKSELIYHAFRDCGYIDGKDQVTDTLKVALKN
NTLTVPEAVAEQKDAIAAVCKKASGNLNIKPAADKRVVALNKELFLGEDFRALWDKIKYK
TTYRVDFDSEELIQKCCDNLQMNLNVGAAKLVYSKAKVSVTEGGVNAAETQRLSVLAADG
KENLPDIVTYLQNRTNLTRRTIVEILTRSKTLPLFKKNPQAYMEDAAKTIASMMRLLIVD
GIKYTKLGDSEFYAQELFDSEELTGYLNRNMIESHRSVYNYVVYDSEVERSFAERFEGSE
SVKVYAKLPDWFKIATPLGSYNPDWAVVIEDNGLNKLYFVVETKGNILADALRPTESAKI
RCGEKHFAALGQGVKFVKADAYERFIEQSVE
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacaatttgacgcaaaccttcaatatcaggagcaggcggtttcggcggtggtc
gatctctttcgcgggcagacgcccaagcagtccaactttactgtttccgcctacgccggg
cagattggcatggaggacaccaaccacggcatcggcaacaagctggagctgaccgaagac
gagcttctcaccaatttgcaggcggtacagctccgcaacggtctgccccagaccaaggcg
ctgaaaaagaatacatacgattttgacgtggagatggaaaccggcaccggcaaaacctat
gtatacttgcgtaccatttttgagctgaacaaggcttatggtttttctaagttcgtcatt
gtggtgcccagcattgccatcaaagagggcgtctacaagaacctgcaaatcacgcaggag
cacttcggcaatctttacgacaacacggtgtacgactacttcatctacgacagcaacaag
ttggagcaggtgcgttcctttgctgtcagtgaccatatttctattatggtcatcaacatc
gacgcctttcgcaaaagctttgacgacccagacaaggagagcaaggcaaacatcattcac
cgccagaacgacaagctcaacgggatgcgccccattgagctgattcaggaaacacgcccc
tttgtgattgtggacgagcctcagtcggtagagggcaagggcgcagtggcttccaaaaag
gccatgacttctctgaacgccctgtgcactctgcgctactccgccacccatgtggtgaag
cacaatctggtctacaagctggacgcagtggacgcctttgacatggagctggtgaagcag
atcgaggtggccagctttgagagcgtggattatcacaacaatgcctacatgaaactcctt
tccgtggacaataaaaaatcgccgatcacggcgaaaattgagatggactgcgaaatcaac
ggcagtgttaagcgtaagccggtgaccgtgcgccagagcgacgatttgtccgaaaagaag
ctgggcaaccgcgcgatttatgagggttacatcgtcgacgaaatctactgcgagcaaggc
aacgaatatgtcagcttctccaccaaaccgaccatcctgcgtatcggtgagaccgtaggc
gacattgacgaccttgccatcaaggagcagcagattcgcaagaccattgaggagcatctg
aataaagaattggcgctaaaccatcgcggcatcaaggtgctgagcctgttcttcatcgac
cgggtagcaaactatcgctattacgacaaggacggcactgcccatcaaggcccctacgcc
gagattttcgagcgtaactacaaggaactcatccagcgacccaagtaccgcaccctgttt
caggatgtggacgtggacaccccggtgggaaaggtacacggcggctatttctcagtggat
aagaaaggcactctgaaagacacaaacggcaccacctccgccgatgacgacacctacaat
ctgattatgaaggataaagagcggctgctgtcctttgaaagcccgctgcgctttatcttc
tctcactctgctttgcgcgagggctgggataaccccaacgtgttccagatctgcacgctg
aacgaaaccaagagcgatgtaaaaaagcggcaggaaatcgggcgcggcctgcgcctgtgc
gtcaaccagaacggtgaacgccagcacggatttgccatcaacacactgacggtcatggcg
aatgagagctacgatgtttttgctaagaagctgcagagcgagtacgagacagacgagggc
attcgtttcggcgtgctggaaagccacagctttgccaatatcccggtcaagcaggcggac
ggcagcgtggcctacctcggcatggagaagtcggagctgatttatcatgcgttccgggat
tgcggctatatcgacggcaaggatcaggtgaccgacacgctgaaagtggcgctgaagaat
aataccctcactgtgccggaagcagtggccgagcagaaggacgccattgcggcagtctgt
aagaaggccagcggaaacctgaatatcaagcctgcggcggacaagcgcgtggtcgcgctg
aacaaagagctgtttttgggcgaggatttccgggcgctgtgggataaaatcaagtacaag
accacctaccgggtggactttgattccgaagaactgattcaaaaatgctgcgacaatctg
cagatgaacctgaacgtgggcgcggccaaattggtgtattccaaggccaaggtcagcgta
acggagggcggcgtaaatgccgccgaaacgcagcggctttcggtactcgctgcggacgga
aaagagaacctgccggatatcgtgacctatctgcaaaaccgcaccaaccttacccgccgc
accattgtggagattctcacccgcagcaagactctgccactgttcaaaaagaacccacag
gcatacatggaggacgccgcaaaaacaattgcctctatgatgcggctgctaatcgtggac
ggcattaagtacactaaacttggggacagcgaattctatgcgcaggagctgttcgattcc
gaggagctgaccggctacctgaaccgcaatatgatcgaaagccaccgcagtgtttacaac
tatgtggtctacgacagtgaggtggagcgtagctttgccgaaaggtttgaaggcagcgaa
agcgtcaaagtctatgccaagctgccagactggttcaagattgcaacgccgctgggcagc
tataaccctgactgggctgtggtcattgaggataacggactgaataagctctatttcgtg
gttgaaacaaagggcaatattctggccgacgcgctgcgccccacggagagcgccaagatt
cgctgcggcgaaaagcactttgcagcactgggtcagggcgtaaaatttgtgaaagcagat
gcctatgaaagattcatagagcaatctgtggaataa

DBGET integrated database retrieval system