KEGG   Oscillibacter valericigenes: OBV_11070Help
Entry
OBV_11070         CDS       T01636                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00010  Glycolysis / Gluconeogenesis
ova00052  Galactose metabolism
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_11070 (galM)
   00052 Galactose metabolism
    OBV_11070 (galM)
Enzymes [BR:ova01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     OBV_11070 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Pcc1
Motif
Other DBs
NCBI-ProteinID: BAK98305
UniProt: G4KW83
Position
1042570..1043628
Genome map
AA seq 352 aa AA seqDB search
MGEVSMNEHVTSFGSTASGEAVEQVTLRSGALSCGILTYGGALRFLTAPDKQGHPVDVVL
GFDTMEDYQKQDKYMGALVGRHANRIGGSKFSLDGKSYSLAANDGSNHLHGGILGFDKQL
WKLESVSDNQAVLSLVSPDMQEGYPGNLSVRVTYTLEGGALTIRYIAQTDRKTICNLTNH
SYFNLAGHASGPVLDQEIQLVAQNFTPADNESLPTGVLAPVAGTPMDLRKLTPIGTHIDD
GFDQLRWAGGYDHNWAVDGEAGVLRPAARAVCRTTGISMDVETTLPGIQFYSANYLDGCP
AGKDGTPYAKRWAFCMETQFFPNATNCPAFAQPVLAPGETFDHTTVYRFATV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggtgtctatgaatgaacatgtgacgtcctttggctctaccgcctccggcgag
gcggtagagcaggtgacactgcgcagcggcgctctttcttgcggcatcttgacctacggc
ggcgcgttgcggtttttaaccgctccggataaacagggccatccggtggacgtggtgctg
ggctttgacaccatggaggactatcaaaagcaggacaaatacatgggcgcgctggtgggc
cgccacgccaaccgcatcggcggcagcaagttttctttggacgggaagtcctattccctt
gctgcaaacgacggttccaaccacctccacggcggcatattgggctttgacaagcaactc
tggaagctggaatccgtatctgacaatcaggcggttttgtctctcgtcagccccgatatg
caggagggctatcccggcaatctgtccgtgcgggtgacctacacgctggaaggcggcgcg
ctcaccatccgctatattgcgcagaccgaccgaaaaaccatctgtaacttgacaaatcac
agctatttcaatctggcgggtcatgcctccgggccggttctcgatcaggagatccaactg
gttgcacagaattttacgcccgccgacaatgaatctctccccactggcgttttggccccc
gttgcgggaactcccatggaccttagaaagctgacccccatcggcacccacatcgatgac
gggtttgaccaactccgctgggcaggcggctacgaccacaattgggccgtggacggagaa
gcgggcgttctgcgcccggcggcccgagctgtttgccgaacgacaggtatctccatggac
gtggagaccacgcttccgggcattcagttctactctgccaattatctggacggctgcccc
gccggaaaggacggcacgccttatgcaaagcggtgggcattctgtatggagactcagttc
ttccccaatgccaccaactgtccggcctttgcccagcctgtgctggctcccggcgagacc
tttgaccacaccacggtttatcgcttcgccacggtctga

DBGET integrated database retrieval system