KEGG   Oscillibacter valericigenes: OBV_11220Help
Entry
OBV_11220         CDS       T01636                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00260  Glycine, serine and threonine metabolism
ova00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01130  Biosynthesis of antibiotics
ova01230  Biosynthesis of amino acids
Module
ova_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_11220 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OBV_11220 (trpB)
Enzymes [BR:ova01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OBV_11220 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-ProteinID: BAK98320
UniProt: G4KWQ5
Position
1058284..1059474
Genome map
AA seq 396 aa AA seqDB search
MTNEKGRFGVHGGQYIPETLMNAVIELEKAYDHYRSDPQFGSELTSLLNDYAGRPSRLYY
AEKMTKDLGGAKIYLKREDLNHTGAHKINNVLGQALLAKKMGKTRLIAETGAGQHGVATA
TAAALMGMECVVYMGREDTERQALNVYKMRLLGAEVVPVDSGTGTLKDAVSAAFREWTNR
IADTHYCLGSVMGPHPFPTIVRDFQSVISKETREQILKKEGRLPDAVLACVGGGSNAIGS
FYHFINDPSVRLIGCEAAGRGVDTLETAATIATGRLGIFHGMKSYFCQDQYGQIAPVYSI
SAGLDYPGIGPEHAHLHDTGRAEYVPVTDEEAVNAFEYLSRTEGIIPAIESAHAVAHAMK
LAPKMGRNQIMVITISGRGDKDCVSIARYRGEDLHE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaaaagggacgcttcggcgtccacggcgggcagtacatcccggagacgctg
atgaatgcggtgatcgagctggagaaggcctatgaccattatcgcagcgacccgcaattt
ggaagcgagctgacgtcgctgttgaacgactatgcgggacggcccagccgactgtactac
gcggagaaaatgaccaaagacttagggggcgcgaagatctatctcaagcgggaggacctg
aaccacaccggcgcccacaagatcaacaacgtactggggcaggcgctgcttgcgaaaaag
atgggcaagacccgtctgattgccgagaccggcgcggggcagcacggcgtggccaccgcc
accgccgccgcactgatgggaatggagtgcgtggtctacatgggccgggaggacacggag
cgtcaggcgctgaacgtctataaaatgcgccttttgggcgcggaggtggtgccggtggac
tccggtacagggacgctgaaggatgccgtctccgcggctttccgggagtggacgaaccgg
attgccgatacccattactgtttgggctccgtcatgggaccccatccgttccccaccatc
gtccgggatttccagagcgtgatctccaaggagaccagagagcagatccttaaaaaggaa
gggcggcttcccgatgcggtactggcctgcgtaggcggcgggtccaacgccatcggctcg
ttttatcacttcatcaatgatccctccgtccggctgatcggctgcgaggcggcgggccgg
ggtgtggatacccttgagaccgccgccaccatcgccaccgggcggctggggatattccac
ggcatgaagtcctacttctgccaggatcaatacggccagatcgccccggtgtattccatc
tctgccggcctcgactatcccggcatcggcccggagcacgcccaccttcatgatacgggc
cgtgcggagtatgtacccgtgacggacgaggaggcggtgaatgcctttgagtacctcagc
cggaccgagggcattatccccgccatcgaatccgcccacgccgtggcccacgccatgaag
ctcgcgccaaagatgggcaggaaccagatcatggtcattacgatttcaggccggggcgat
aaggactgcgtctccatcgcccgttatagaggggaggaccttcatgagtaa

DBGET integrated database retrieval system