KEGG   Oscillibacter valericigenes: OBV_11220Help
Entry
OBV_11220         CDS       T01636                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OBV_11220 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_11220 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OBV_11220 (trpB)
Enzymes [BR:ova01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OBV_11220 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1058284..1059474
Genome map
AA seq 396 aa AA seqDB search
MTNEKGRFGVHGGQYIPETLMNAVIELEKAYDHYRSDPQFGSELTSLLNDYAGRPSRLYY
AEKMTKDLGGAKIYLKREDLNHTGAHKINNVLGQALLAKKMGKTRLIAETGAGQHGVATA
TAAALMGMECVVYMGREDTERQALNVYKMRLLGAEVVPVDSGTGTLKDAVSAAFREWTNR
IADTHYCLGSVMGPHPFPTIVRDFQSVISKETREQILKKEGRLPDAVLACVGGGSNAIGS
FYHFINDPSVRLIGCEAAGRGVDTLETAATIATGRLGIFHGMKSYFCQDQYGQIAPVYSI
SAGLDYPGIGPEHAHLHDTGRAEYVPVTDEEAVNAFEYLSRTEGIIPAIESAHAVAHAMK
LAPKMGRNQIMVITISGRGDKDCVSIARYRGEDLHE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaaaagggacgcttcggcgtccacggcgggcagtacatcccggagacgctg
atgaatgcggtgatcgagctggagaaggcctatgaccattatcgcagcgacccgcaattt
ggaagcgagctgacgtcgctgttgaacgactatgcgggacggcccagccgactgtactac
gcggagaaaatgaccaaagacttagggggcgcgaagatctatctcaagcgggaggacctg
aaccacaccggcgcccacaagatcaacaacgtactggggcaggcgctgcttgcgaaaaag
atgggcaagacccgtctgattgccgagaccggcgcggggcagcacggcgtggccaccgcc
accgccgccgcactgatgggaatggagtgcgtggtctacatgggccgggaggacacggag
cgtcaggcgctgaacgtctataaaatgcgccttttgggcgcggaggtggtgccggtggac
tccggtacagggacgctgaaggatgccgtctccgcggctttccgggagtggacgaaccgg
attgccgatacccattactgtttgggctccgtcatgggaccccatccgttccccaccatc
gtccgggatttccagagcgtgatctccaaggagaccagagagcagatccttaaaaaggaa
gggcggcttcccgatgcggtactggcctgcgtaggcggcgggtccaacgccatcggctcg
ttttatcacttcatcaatgatccctccgtccggctgatcggctgcgaggcggcgggccgg
ggtgtggatacccttgagaccgccgccaccatcgccaccgggcggctggggatattccac
ggcatgaagtcctacttctgccaggatcaatacggccagatcgccccggtgtattccatc
tctgccggcctcgactatcccggcatcggcccggagcacgcccaccttcatgatacgggc
cgtgcggagtatgtacccgtgacggacgaggaggcggtgaatgcctttgagtacctcagc
cggaccgagggcattatccccgccatcgaatccgcccacgccgtggcccacgccatgaag
ctcgcgccaaagatgggcaggaaccagatcatggtcattacgatttcaggccggggcgat
aaggactgcgtctccatcgcccgttatagaggggaggaccttcatgagtaa

DBGET integrated database retrieval system