KEGG   Oscillibacter valericigenes: OBV_11230Help
Entry
OBV_11230         CDS       T01636                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OBV_11230 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OBV_11230 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OBV_11230 (trpA)
Enzymes [BR:ova01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OBV_11230 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1059467..1060243
Genome map
AA seq 258 aa AA seqDB search
MSNIAKAFEKGKAFVPFLTCGDPDLETTEKLVKAMADSGADLIELGIPFSDPTAEGPVIQ
EANVRALAGGVTTDKIFDMVRRLRVTVTVPMVFMTYANVVFSYGPEKFISICADLGIDGL
ILPDVPYEEKDEFAPICRQYGLDLISMIAPTSESRIAMIAKEADGFIYMVSSLGVTGVRS
EIKTDIGAMAALVRANSRRPCAVGFGISTPEQAKKMAALSDGAIVGSAIVKLVARYGREA
VPFVADYVKSMADATHSA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgcaaaggcctttgaaaagggcaaggcgttcgttccgtttctcacctgc
ggcgacccggatctggagaccacggagaagctggtaaaagcgatggcggacagcggggcg
gatctgattgagctgggcatcccgttttccgaccccacggcggagggtcccgtcattcag
gaggccaatgtccgggcgctggcggggggcgttaccaccgacaagattttcgatatggtg
cgccgcctccgcgtcactgtcacggttcccatggtttttatgacctatgccaatgtggtt
ttttcttacgggcccgagaaattcatctccatctgcgcagatctcggcatcgacggcctg
atcctgccggatgtcccctatgaggaaaaggacgaattcgcgccgatttgcaggcaatac
ggtctggatttgatctccatgatcgcccccacttcggaaagccgcatcgccatgatcgca
aaggaggccgacggctttatctatatggtctcgtctctgggggttaccggcgtgcgcagc
gaaattaaaacagacatcggcgccatggcggctctggtacgggccaacagccggcgcccc
tgcgcggtgggcttcggcatctccacgccggagcaggccaaaaaaatggccgctctttcc
gacggggccatcgtgggcagcgccatcgtgaagctggtggctcggtatggccgggaagcg
gttccctttgtagcggactacgtgaaatccatggcggacgcgacccactcggcatga

DBGET integrated database retrieval system