KEGG   Oscillibacter valericigenes: OBV_11630Help
Entry
OBV_11630         CDS       T01636                                 

Definition
peptidase M20A family protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ova  Oscillibacter valericigenes
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OBV_11630
  Amino acid metabolism
   00300 Lysine biosynthesis
    OBV_11630
Enzymes [BR:ova01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OBV_11630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093942..1095090)
Genome map
AA seq 382 aa AA seqDB search
MDSSEREAALRLLKEILAIPSVNGKDDEGAVARYLCAVFEKAGISASLQKIDALHSNVIA
VLDGANSSDSAIWNGHLDTVPYGDRAAWETDPAVPVERDGFVYGRGASDMKSGLAAMVFA
LCSFASSGRRPARRTVFLGTCDEERNGIGASAILRDQLLPPCSTLLIGEPTGNNFGVAQK
GCYWMQILAEGKTSHGAYPEQGCNAVEHGVALADALKAHLQTYRHPILGGATAQITKIEG
GVAPNMTPDRCSLLMDIRTVPDISRDRLMTLASTLAEKETACYHKMGLNLHISLLNDRPS
IEISKGHPMLLRLQEAAEKYCGGGKPVGISFFTDASILVKDRPETAVLLFGPGEPELAHK
PNEAVRIEKYFQAISVYKDLLA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggacagttctgaacgggaagcggcgctccgccttctaaaagagattcttgcaattcca
agcgtcaacggaaaagatgacgaaggcgctgtggcccgctatctgtgcgccgtttttgaa
aaggccggcatttctgccagccttcagaaaattgatgccctccacagtaatgtcatcgcc
gttctcgacggtgcaaacagttcggacagcgctatctggaacggccacttggatacggtt
ccatacggtgaccgcgccgcgtgggaaactgatcccgcagttcccgtcgaacgggacggc
tttgtgtatggccgcggtgccagtgatatgaaaagcggccttgcggccatggtctttgct
ctttgctctttcgcctcttccggccgcaggcctgcccgccgtacggtatttctcggcacc
tgcgacgaagagcgcaacggaatcggagcatctgccatcctccgcgaccagctgctgccc
ccctgttccactcttttgatcggggaaccaaccggcaacaacttcggtgttgctcagaag
gggtgctactggatgcaaattctggcagagggcaaaaccagccacggcgcctatcccgag
caggggtgcaacgcggtggagcatggcgttgcgctagccgacgctcttaaggcgcatctc
cagacttaccgacatcccatattgggtggcgccacggcacagattaccaaaattgagggc
ggtgttgcgcctaatatgacaccggaccgctgctctttgctaatggatatccgaaccgtt
cccgatatcagccgggatcgattgatgaccctggcctccacgcttgcagaaaaagaaact
gcatgttatcataaaatgggtttaaatttacacataagtcttttgaatgaccgcccctcc
attgagatttcgaaagggcatcctatgcttctgcggcttcaggaggctgcggaaaagtat
tgcggcggcggaaaaccagtgggtatcagcttctttacagatgcttccattctggtgaag
gaccggccggagacggctgttctgctctttggtcccggtgaacccgagctagctcacaag
cccaatgaggccgtacggattgagaagtattttcaggcaatttccgtttataaggatctt
ttggcttga

DBGET integrated database retrieval system