KEGG   Oscillibacter valericigenes: OBV_12670Help
Entry
OBV_12670         CDS       T01636                                 

Gene name
sepB
Definition
putative agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ova  Oscillibacter valericigenes
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OBV_12670 (sepB)
Enzymes [BR:ova01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     OBV_12670 (sepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207851..1208702
Genome map
AA seq 283 aa AA seqDB search
MRDKNVQTFLACDAEYGAADVVLFGVPFDGTTSFRPGTRFGPSAIRGESFGIETYSPYCD
RDLTDCRIFDGGDLELPFGNTQRVLELIRDSAADLLADGKRFVMLGGEHLITLGAVRAVA
ERFPDVHVIQFDAHTDLRKEYLGEPLSHSTVMRQVWNLLGDGRLHQFGIRSGERTEFEFA
REHTCLHKFNLADFTETAAQLQGMPVYFSLDLDVLDSSAFCGTGTPEAGGVTFKELMEAV
LRLHGLNIVGCDINELSPHYDHSGSSTAAACKITREILLQIAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagggataagaacgtacagacatttctggcctgcgacgccgagtacggcgcggccgat
gtggtgctgttcggcgtccccttcgacggaaccacgtccttccgccccggcacccggttc
ggcccctccgccatccggggcgaatccttcggcattgaaacctattccccatactgtgac
agggacctcacagactgccgaattttcgacggcggggatctggagctgcccttcggcaac
acccaaagggtgctggagctgatccgggacagcgccgcggaccttctggccgacggtaag
cgctttgtgatgctgggcggcgagcacctcatcaccctgggcgccgtgcgcgccgtggca
gagcgctttccagatgtacacgtcattcaattcgacgcccacaccgacctgcgcaaggaa
tacctgggggagcctctctcccattccaccgttatgcggcaggtgtggaatctgctgggg
gacgggagactccaccagttcggcatccgcagcggagagcgtacggaatttgaattcgcg
agggagcacacgtgccttcacaaattcaatctggcggactttacagagaccgcggcgcag
cttcagggcatgccggtgtatttctcgctggatctggacgtgctggattcctccgccttt
tgcggcaccggcacgccggaggccggcggagtcacctttaaggagctgatggaggcggtg
ctgcggctgcatggattgaacatcgtgggctgcgacatcaatgagctctccccccactat
gaccacagcggcagctccacggccgccgcctgcaaaatcacccgggaaatcttattgcaa
attgcaagataa

DBGET integrated database retrieval system