KEGG   Oscillibacter valericigenes: OBV_12820Help
Entry
OBV_12820         CDS       T01636                                 

Gene name
xfp
Definition
xylulose-5-phosphate phosphoketolase/fructose-6-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ova  Oscillibacter valericigenes
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ova00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229894..1232260
Genome map
AA seq 788 aa AA seqDB search
MSECVEKQPLTEEYLKKMDAYWRAANYLAAAQLYLLKNPLLREPLTMDDIKKKIVGHWGT
VPGQNFVYVHLNRIIKKYDQDMILLSGPGHGGNFFVANTYLEGTYSEVYPNISRDMEGLQ
KLCKQFSFPGGIASHVAPETPGSINEGGELGYSLAHAYGAVFDNPDLIAAVTVGDGEAET
GPLATSWQGNKFLNPAADGAVLPILHLNGYKISNPTIFARMTHEQLECYFKGCGWKAHFV
EGDDPMTMHRLMADTLDEVMGEIKGIQAAARAGDHSWKDWPMIVLRTPKGWTGPKVVDGK
QVEGTFRAHQVPISMEKPEHLEQLKDWLESYRPGELFDENGHLIPELQALAPTGERRIGA
NPHANGGKLRRDLRLPDFRDYAVDVPAPGAVEAQDMIELGGYVRDTFKLNKDAKNFRIFG
PDETMSNRLGKVFEVTGRDWNSATVEGDEFLSADGRVMDSMLSEHMCEGMLEGYLLTGRH
GFFASYEAFIRIVDSMCAQHAKWLKTCNELPWRESISSLNLILSSNVWQQDHNGFTHQDP
GFLDHIANKKADVVRLYLPPDANCLLSCFDHCIKSRDYVNVLVTSKHPRPQWLTMEQAVK
HCTQGVGIWDWASNDQGCEPDVVMACCGDTPTMETLAAVTILREKMPEIKIRVVNVVDLM
KLQPSTEHPHGLSDAEYDALFTTNKPIIFAFHGYHTLIHELTYRRHNRNIHVYGYKEEGT
ITTPFDMRVQNEVDRFHLVKNVLRYLPELGGRSAHLVQEMNDKLVQHTQYVHEYGVDLPE
IRDWKWRS
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatgtgtggaaaagcagccgctgacagaggaatatctcaaaaagatggacgcc
tactggcgtgccgccaattatctggccgcggcccagctctatcttttaaagaaccccttg
ctccgggagcccctgaccatggatgacatcaaaaagaagatcgtgggccactggggcact
gttcccggccagaacttcgtgtacgtccacctcaaccgcatcatcaaaaagtatgaccag
gatatgattctcctgtccggacccggccacggcggaaatttctttgtggccaacacgtat
ctggaggggacttacagcgaggtttaccccaacatcagccgggacatggagggacttcaa
aagctttgcaagcagttttccttccccggcggcattgccagccatgtggccccggagacg
ccgggctccattaacgagggcggtgagttgggttactccctggcccatgcctacggcgcg
gtattcgacaatccggacctgatcgccgctgtcacggtgggcgacggtgaggcggagacc
ggcccgctggcgacgtcctggcagggcaacaagtttctcaatcccgccgccgatggcgcg
gtgcttcccattctccatttaaacggctataagatcagcaaccccactatttttgcccgc
atgacccatgagcaactggagtgttacttcaagggctgcggctggaaggcacacttcgtg
gagggagacgaccctatgaccatgcaccgcctgatggcggatacgctggacgaggttatg
ggcgagatcaagggcattcaggccgccgccagagcgggcgaccacagctggaaggactgg
cccatgatcgtgctgcggactcccaagggctggaccggccccaaggtggtggacggcaag
caggtcgagggcaccttccgcgctcaccaagtacccatctccatggaaaaaccggaacat
ttggagcagctgaaagactggctggagagctaccgcccgggggagctgttcgacgagaac
ggccacctgatccccgagttgcaggctttggctcccaccggggaacggcgcatcggtgcc
aacccccatgccaatggcggaaagcttcgccgggacctgcgcctaccggatttccgggac
tatgcggtggatgttcccgcccccggcgcggtggaggcgcaggacatgatcgagctgggc
ggctatgtgcgggatacgttcaagctcaacaaggatgcgaagaacttccgcattttcggg
ccggacgagaccatgagcaaccgtctgggcaaagttttcgaggtcaccggccgcgattgg
aacagcgcgaccgtggagggcgacgaattcctctccgcggacggccgggtcatggactcc
atgctctccgagcacatgtgcgaggggatgctggagggatatctgctcaccggtcggcac
ggcttctttgcaagctatgaggcattcatccgcatcgtagactccatgtgcgcccagcac
gccaaatggctgaagacctgcaacgagcttccgtggagagagtccatctcctcgctgaac
ctgattttgtcctccaacgtctggcagcaggaccacaacggctttacccatcaggacccc
ggcttcctggaccacattgccaataaaaaggcggacgtggtacggctctatctgccgccg
gacgccaattgccttttgagctgttttgaccactgcatcaagagtcgggactatgtgaac
gtgctggtcaccagcaagcatccccgtccccagtggttgacgatggaacaggccgtcaag
cactgcacgcagggcgtgggcatctgggactgggccagcaacgatcagggctgcgagccg
gatgtggtcatggcctgctgcggcgacacgcctaccatggagacgctggcagcggtcacg
atcctgcgggagaagatgcccgaaatcaagatccgggtcgtcaacgtggtggacctgatg
aagctccagcccagcacggagcacccccacggtctcagcgacgcggagtacgacgcgctg
tttaccacaaataagcccataatttttgcgtttcacggttaccataccctcattcatgag
ctgacctaccgccgccacaaccgcaacattcatgtgtacggctataaggaggaggggacc
attaccacgcccttcgatatgcgggtgcagaacgaggtggaccggttccatctggtgaaa
aacgtcctgcggtatctgccggagctgggtgggcgcagcgcccatctggtacaggagatg
aacgacaagctggtgcagcacacccagtatgtccacgagtatggcgtggacctgccggag
atccgcgactggaaatggcgcagctga

DBGET integrated database retrieval system