KEGG   Oscillibacter valericigenes: OBV_13470Help
Entry
OBV_13470         CDS       T01636                                 

Gene name
porC
Definition
(GenBank) pyruvate synthase subunit PorC (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ova  Oscillibacter valericigenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ova00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OBV_13470 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OBV_13470 (porC)
   00020 Citrate cycle (TCA cycle)
    OBV_13470 (porC)
   00620 Pyruvate metabolism
    OBV_13470 (porC)
   00640 Propanoate metabolism
    OBV_13470 (porC)
   00650 Butanoate metabolism
    OBV_13470 (porC)
  Energy metabolism
   00680 Methane metabolism
    OBV_13470 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    OBV_13470 (porC)
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     OBV_13470 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1289265..1289843
Genome map
AA seq 192 aa AA seqDB search
MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSER
STVHSNIYFPDYVVVVDETLIASVDVTAGLKEQGAIVINSNKTPAELRAKLKGYKGKVCT
IDAGKISEEELGKNFPNTPMLAAIVKISGVVEEKEFIKDMEASFKHKFASKPQVIEGNMR
ALKRSMEEVQVG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatcgtagagatccgttggcacggacggggcgggcagggcgcgaagacagcg
tcgctgctgctggccgacgcggcgttcaacacgggcaagtacgtccagggttttccggag
tacggcccggagcgcatgggcgcgcccatcacggcgtacaaccgcatcagctctgagcgg
agcacggtacattccaacatttacttccccgactacgtggtggtggtggacgagaccctg
atcgcgtccgtggacgtgaccgcgggattgaaggaacagggggccatcgtcatcaattcc
aacaagaccccggccgagctgcgcgcgaagctgaagggctacaagggcaaggtgtgtacc
atcgatgcgggaaagatcagtgaggaggagctgggtaaaaacttccccaacacccccatg
ctggccgccatcgtgaagatctccggcgtggtggaggaaaaggagttcattaaggacatg
gaggcttccttcaagcacaagtttgcaagcaagccccaggtcatcgagggcaatatgcgc
gcattgaagcgctctatggaggaggtacaggtaggatga

DBGET integrated database retrieval system